DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11703 and secisbp2l

DIOPT Version :9

Sequence 1:NP_650792.1 Gene:CG11703 / 42307 FlyBaseID:FBgn0038690 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001164297.1 Gene:secisbp2l / 733798 XenbaseID:XB-GENE-988601 Length:1078 Species:Xenopus tropicalis


Alignment Length:153 Identity:29/153 - (18%)
Similarity:55/153 - (35%) Gaps:24/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 EASENMRGVTRVVAIQMNKMPENAKTFFSCKVWARNIPIDD----DYQ--GMGIIKFALSMRTDD 280
            :|.|.::.:.:|..:..::.|..|.....|.|.:.  ||.:    ||:  ...:::.:..:.|.:
 Frog   820 QAEEALKNIKKVPHMGHSRNPSAASAISFCSVISE--PISEVNEKDYETNWRNMVETSDGLETSE 882

  Fly   281 D-------------GNPDFERPSTRK-APREIDLESEELVPEPPSPNRPESML--GGLELPPPPE 329
            :             .:....|.:|:| .|:.....:.....|.|:|...|.:.  ..||......
 Frog   883 NEECSVTTTGSEQAASAPLVRNNTQKQEPKTASSTTSSATLEKPTPADKEEVKQDDNLEWASQQS 947

  Fly   330 DEKDALDAMGNDAKKEEMTEPPS 352
            .|..:.|..|.|.....||...|
 Frog   948 TETGSWDGSGRDVLNSSMTSTAS 970

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11703NP_650792.1 Na_K-ATPase 32..267 CDD:298651 11/50 (22%)
secisbp2lNP_001164297.1 Ribosomal_L7Ae 693..795 CDD:279573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165178326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.