DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11703 and SHBG

DIOPT Version :9

Sequence 1:NP_650792.1 Gene:CG11703 / 42307 FlyBaseID:FBgn0038690 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001031.2 Gene:SHBG / 6462 HGNCID:10839 Length:402 Species:Homo sapiens


Alignment Length:177 Identity:32/177 - (18%)
Similarity:55/177 - (31%) Gaps:70/177 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 DTPDDLPKEAPASLQDTVGKLGNTPKIWITCEVTNGPKPEMVFYPGPYFEASENMRGVTRVVAIQ 237
            |...::...||.||:              :|:|.:.|.   :|.| |..:|..|:|.:.:..|  
Human   201 DKQAEISASAPTSLR--------------SCDVESNPG---IFLP-PGTQAEFNLRDIPQPHA-- 245

  Fly   238 MNKMPENAKTFFSCKVWARNIPIDDDYQGMGIIKFA----------------LSMRTDDD----- 281
                          :.||.::       .:|:.:.|                ||:...|.     
Human   246 --------------EPWAFSL-------DLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLS 289

  Fly   282 --GNPDFERPSTRKAPREIDLESEELVPEPPSPNRPESMLGGLELPP 326
              ..|..:.|.....|.::.|....:|..      ..|.:..|.|||
Human   290 SGSGPGLDLPLVLGLPLQLKLSMSRVVLS------QGSKMKALALPP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11703NP_650792.1 Na_K-ATPase 32..267 CDD:298651 17/93 (18%)
SHBGNP_001031.2 Laminin_G_1 75..205 CDD:278483 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.