DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11703 and ATP1B1

DIOPT Version :9

Sequence 1:NP_650792.1 Gene:CG11703 / 42307 FlyBaseID:FBgn0038690 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001668.1 Gene:ATP1B1 / 481 HGNCID:804 Length:303 Species:Homo sapiens


Alignment Length:314 Identity:75/314 - (23%)
Similarity:120/314 - (38%) Gaps:87/314 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RRKKDLPWSKRIFDIDEHKLFGRTALGWMRITGFYLVLYALIVCIVAFWLGIF--MLAIIDPNKP 87
            :.|::..|.|.|::.::.:..|||...|.:|..||::.|.   |:...::|..  ||..|...||
Human     5 KAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYG---CLAGIFIGTIQVMLLTISEFKP 66

  Fly    88 RWLK--GPPGLSMV-----------PNQNRSVLAYFTHIMSEVNPIADRIDDFLNKLNDNA--ID 137
            .:..  .||||:.:           ||..:|..||..:|:.           ||.|..|:|  .|
Human    67 TYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVR-----------FLEKYKDSAQRDD 120

  Fly   138 FF--------------ADFN----------------------QDTTWGYATEKPTVFIKLNKVIG 166
            ..              .|||                      .|.|:||...||.:.||||:|:|
Human   121 MIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLG 185

  Fly   167 YVP--------ETYD----TPDDLPKEAPASLQDTVGKLGNTPKIWITCEVTNGPKPEMVFYPGP 219
            :.|        |||.    .|:.||.:......:...|:||.....:    .|.|...:.:|  |
Human   186 FKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGL----GNSPGFPLQYY--P 244

  Fly   220 YFEASENMRGVTRVVAIQMNKMPENAKTFFSCKVWARNIPID--DDYQGMGIIK 271
            |:......:.:..::|:|...:..:.:....||.:..||...  |.:||...:|
Human   245 YYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11703NP_650792.1 Na_K-ATPase 32..267 CDD:298651 72/301 (24%)
ATP1B1NP_001668.1 Na_K_ATPase_bet 1..303 CDD:273446 75/314 (24%)
immunoglobulin-like 191..303 24/114 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5606
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.