DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11703 and CG5250

DIOPT Version :9

Sequence 1:NP_650792.1 Gene:CG11703 / 42307 FlyBaseID:FBgn0038690 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_650793.1 Gene:CG5250 / 42308 FlyBaseID:FBgn0038691 Length:311 Species:Drosophila melanogaster


Alignment Length:300 Identity:72/300 - (24%)
Similarity:133/300 - (44%) Gaps:57/300 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPEDVMVPAGDYKLVKQIRRNQETRRKKDLPWSKRIFDIDEHKLFGRTALGWMRITGFY-LVLYA 64
            ||.|.::.:|.|:|.:       .||::|:..::.::   ...:..|.|...|.:..|. |:|| 
  Fly     1 MPNDAIIYSGPYELGR-------LRRRRDMRVAEYLY---RRSIRTRNADPEMTVCRFIKLLLY- 54

  Fly    65 LIVCIVAFW--LGIFMLAI--------IDPNKPRWLKGPPGLSMVPNQ---NRSVLAYFTHIMSE 116
                .:.|:  ||:|...:        |.|::| ..|..|||:..|..   ::..:.:..:.:.:
  Fly    55 ----FIGFFFVLGVFTTGLALVMIANHIYPDRP-GCKKFPGLATAPGHHVGDQKQIMWSPNNIKD 114

  Fly   117 VNPIADRIDDFLNKLNDNAIDFFADFNQDTTWGYATEKPTVFIKLNKVIGYVPETYDTPDDLPKE 181
            |..|...|...:.:............|.|.:|||.:..|.:.||:.:.:|:...|||....||:.
  Fly   115 VANIQRAIMRTVKRYGLEGPKRLMGCNIDDSWGYMSGTPCILIKITQALGFQAVTYDDALTLPEY 179

  Fly   182 APASLQDTVGKLGNTP---KIWITCEVTNGPKPEMVF--YPGPYFEASENMRG------------ 229
            ||..|.|.|..||:..   :||::|:|.. |:.::.|  :|..:|:|.|....            
  Fly   180 APDELFDYVVGLGSEERFNRIWVSCQVIE-PRVDIQFDYHPVRFFDAEELFTSGNVFLNESSDDD 243

  Fly   230 ---------VTRVVAIQMNKMPENAKTFFSCKVWARNIPI 260
                     :.|:::::::.:|.|......||.||:|||:
  Fly   244 GPTYKEDPRLRRIISVRLSNIPINEDIQIHCKAWAKNIPL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11703NP_650792.1 Na_K-ATPase 32..267 CDD:298651 63/268 (24%)
CG5250NP_650793.1 Na_K-ATPase <143..281 CDD:298651 37/138 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473145
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.