DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11703 and atp1b3

DIOPT Version :9

Sequence 1:NP_650792.1 Gene:CG11703 / 42307 FlyBaseID:FBgn0038690 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_989087.1 Gene:atp1b3 / 394687 XenbaseID:XB-GENE-485127 Length:279 Species:Xenopus tropicalis


Alignment Length:279 Identity:68/279 - (24%)
Similarity:113/279 - (40%) Gaps:78/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WSKRIFDIDEHKLFGRTALGWMRITGFYLVLYALIVCI--VAFWLGIFMLAIIDPNKPRWLK--G 92
            |.:.|::....:..||||..|..|..||||.|..:..:  :..|:   ||..:|.:.|::..  .
 Frog    16 WKQFIYNPQSGEFMGRTASSWALILLFYLVFYGFLAGLFTLTMWV---MLQTLDDSVPKYRDRVS 77

  Fly    93 PPGLSMVP-----------NQNRSVLAYFTHIMSEVNPIADRIDDFLNKLNDNAIDFFAD----- 141
            .|||.:.|           |:.:|...|...:.:.:.|..|.| ...|.|....:.|..|     
 Frog    78 SPGLMISPKSAGLEIKFTRNKTQSYQEYIQTLHTFLTPYNDAI-QAKNDLCAPGLYFDQDEKDEK 141

  Fly   142 ----FN----------QDTTWGYATEKPTVFIKLNKVIGYVPETYDTPDDLPKEAPASLQDTVGK 192
                ||          :|.|:||...||.|.:|:|::||..||                      
 Frog   142 KACQFNRSSLGLCSGIEDNTFGYNEGKPCVIVKMNRIIGLKPE---------------------- 184

  Fly   193 LGNTPKIWITCEV---------TNGPKPEMVFYPGPYFEASENMRGVTRVVAIQMNKMPENA--- 245
             || |||..|.:.         .|| |.:::::  ||:....::..|..:||:::...|.|:   
 Frog   185 -GN-PKINCTSKTEDVNLQYFPENG-KIDLMYF--PYYGKKTHVNYVQPLVAVKIIPPPYNSSLD 244

  Fly   246 KTFFSCKV-WARNIPIDDD 263
            :....||: .:||:..:|:
 Frog   245 EISLECKIHGSRNLKNEDE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11703NP_650792.1 Na_K-ATPase 32..267 CDD:298651 68/279 (24%)
atp1b3NP_989087.1 Na_K-ATPase 14..272 CDD:366001 68/279 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.