DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11703 and CG33310

DIOPT Version :9

Sequence 1:NP_650792.1 Gene:CG11703 / 42307 FlyBaseID:FBgn0038690 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:333 Identity:79/333 - (23%)
Similarity:130/333 - (39%) Gaps:88/333 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDYKL-VKQIRRNQETRRKKDLP----WSKRIFDIDEHKLFGRTAL----GWMRITGFYLVLYAL 65
            |.||: .|:.||......:...|    |.:..|    :|:.|:..|    .|: .|..:.|||.|
  Fly   557 GPYKMPTKEDRRTYYKGCEYHFPGRTEWRRLFF----NKIHGKYKLRRPSHWL-YTLVFSVLYIL 616

  Fly    66 IVCIVAFWLGIFMLAIID-----------------------PNKPRWLKGPPGLSMVPNQNRSVL 107
            .|.       ||.:|..|                       |..||  ..|..:|..|..:..|:
  Fly   617 FVI-------IFSMAWFDFIKDDASRKVPMIKMAQPFISFTPIGPR--TNPKAVSFDPRNSTEVM 672

  Fly   108 AYFTHIMSEVNPIADRIDDFLNKLNDNAID-FFADFNQDTTWGYATEKPTVFIKLNKVIGYVPET 171
            ..:..||:           .|.|..|...: .|.....:..:||.:.:|.||:|:|::||:..|.
  Fly   673 EKYAGIMA-----------LLEKYGDYGHNPRFGTCTANEKFGYPSGEPCVFLKVNRIIGFKTEP 726

  Fly   172 YDTPDDLPK------EAPA---SLQDTVGKLGNTPKIWITCEVTNGPKPEMVFYPGP-----YFE 222
            |...|:|.|      |..|   .|::|..:.|:..:.||||.........:.|:|.|     |.:
  Fly   727 YINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYTD 791

  Fly   223 ASENM--------------RGVTRVVAIQMNKMPENAKTFFSCKVWARNIPIDDDYQGMGIIKFA 273
            ..|.:              ..|.|:||:::..:..|.:...:||:||:|  |....:|.|.:.|.
  Fly   792 IEEKIEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQN--IHHRKEGYGQVSFF 854

  Fly   274 LSMRTDDD 281
            :.:.|:::
  Fly   855 VLLATNEN 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11703NP_650792.1 Na_K-ATPase 32..267 CDD:298651 68/290 (23%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 39/145 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5606
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.