DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11703 and Atp4b

DIOPT Version :9

Sequence 1:NP_650792.1 Gene:CG11703 / 42307 FlyBaseID:FBgn0038690 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_036642.2 Gene:Atp4b / 24217 RGDID:2178 Length:294 Species:Rattus norvegicus


Alignment Length:305 Identity:62/305 - (20%)
Similarity:112/305 - (36%) Gaps:103/305 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DEHKLFGRTALGWMRITGFYLVLYALIVCIVAFWLGIFMLAI------IDPNKPRW---LKGPPG 95
            |..::.|||...|:.|:.:|...|.::.       |:|.|.|      |||..|.:   ||. ||
  Rat    25 DTGQMLGRTPARWVWISLYYAAFYVVMT-------GLFALCIYVLMQTIDPYTPDYQDQLKS-PG 81

  Fly    96 LSMVPN-------------QNRSVLAYFTH----IMSEVNPIADRIDDFLNKLNDN--------- 134
            :::.|:             ...|..|..||    .::...|.:.:  |.:|..::.         
  Rat    82 VTLRPDVYGERGLQISYNISENSSWAGLTHTLHSFLAGYTPASQQ--DSINCSSEKYFFQETFSA 144

  Fly   135 ------AIDFFADFNQ------DTTWGYATEKPTVFIKLNKVIGYVPETYDTPDDLPKEAPASLQ 187
                  :..|.||..|      |.::|:...||...||:|:::.::|.....|.           
  Rat   145 PNHTKFSCKFTADMLQNCSGLVDPSFGFEEGKPCFIIKMNRIVKFLPSNNTAPR----------- 198

  Fly   188 DTVGKLGNTPKIWITCEVTNGP-KP-------EMVFYPG---------PYFEASENMRGVTRVVA 235
                         :.|...:.| ||       ::.:||.         ||:...........:||
  Rat   199 -------------VDCTFQDDPQKPRKDIEPLQVQYYPPNGTFSLHYFPYYGKKAQPHYSNPLVA 250

  Fly   236 IQMNKMPENAKTFFSCKVWARNIPID---DDYQGMGIIKFALSMR 277
            .:...:|:|.:....||:.|.::..|   |.|:|.  ::|.|:::
  Rat   251 AKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGK--VEFKLTIQ 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11703NP_650792.1 Na_K-ATPase 32..267 CDD:298651 59/293 (20%)
Atp4bNP_036642.2 Na_K_ATPase_bet 2..294 CDD:273446 62/305 (20%)
immunoglobulin-like. /evidence=ECO:0000250 194..294 22/126 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354515
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.