DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11703 and Atp1b2

DIOPT Version :9

Sequence 1:NP_650792.1 Gene:CG11703 / 42307 FlyBaseID:FBgn0038690 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_036639.2 Gene:Atp1b2 / 24214 RGDID:2171 Length:290 Species:Rattus norvegicus


Alignment Length:298 Identity:62/298 - (20%)
Similarity:109/298 - (36%) Gaps:92/298 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WSKRIFDIDEHKLFGRTALGWMRITGFYLVLYALIVCI--VAFWLGIFMLAIIDPNKPRWLK--G 92
            |.:.:::...|:..|||...|..|..||||.|..:..:  :..|:   ||..:..:.|::..  .
  Rat    17 WKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWV---MLQTVSDHTPKYQDRLA 78

  Fly    93 PPGLSMVP-NQNRSVLAYFTHIMSEVNPIADRIDDFLNKLNDN---------------------A 135
            .|||.:.| .:|..|:...:...|....: .:::.||...||:                     .
  Rat    79 TPGLMIRPKTENLDVIVNISDTESWDQHV-QKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGV 142

  Fly   136 IDF---FADFNQ-----------DTTWGYATEKPTVFIKLNKVIGYVPETYDTPDDLPKEAPASL 186
            :::   ...||:           .|.:||:|.:|.||||:|:||.:.                  
  Rat   143 LNYPKRACQFNRTQLGNCSGIGDPTHYGYSTGQPCVFIKMNRVINFY------------------ 189

  Fly   187 QDTVGKLGNTPKIWITCEVTNGPKPE-------MVFYPG---------PYFEASENMRGVTRVVA 235
                  .|....:.:||.   |.|.|       .:.:|.         ||:....::.....:||
  Rat   190 ------AGANQSMNVTCV---GKKDEDAENLGHFIMFPANGNIDLMYFPYYGKKFHVNYTQPLVA 245

  Fly   236 IQMNKMPENAKTFFSCKVWARNIPIDDDYQGMGIIKFA 273
            ::...:..|.:....|::.|.||..||:..     |||
  Rat   246 VKFLNVTPNVEVNVECRINAANIATDDERD-----KFA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11703NP_650792.1 Na_K-ATPase 32..267 CDD:298651 59/290 (20%)
Atp1b2NP_036639.2 Na_K_ATPase_bet 2..289 CDD:273446 62/298 (21%)
immunoglobulin-like. /evidence=ECO:0000250 193..290 20/94 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354516
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.