DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11703 and nkb-1

DIOPT Version :9

Sequence 1:NP_650792.1 Gene:CG11703 / 42307 FlyBaseID:FBgn0038690 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_492506.1 Gene:nkb-1 / 182726 WormBaseID:WBGene00007646 Length:320 Species:Caenorhabditis elegans


Alignment Length:313 Identity:69/313 - (22%)
Similarity:121/313 - (38%) Gaps:96/313 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KKDLPWSKR--IFDIDEHKLFGRTALGWMRITGFYLVLYALIVCIVAFW---LGIFMLAIIDPNK 86
            :.|:|.:.|  :::.....:.|||...|.:|..||::.||.   :.|||   |.||| ..:||..
 Worm    22 RDDVPETFREFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAF---LAAFWLTCLTIFM-KTLDPKV 82

  Fly    87 PR------------------WLKGPPGLSMVPNQNRSVLAYFTHIMSEVNPIADRIDDFLNKLND 133
            ||                  |||..|..:::....|...:|..::        :::..:|.|.:.
 Worm    83 PRFYGKGTIIGVNPGVGYQPWLKERPDSTLIKYNLRDQKSYKAYL--------EQMKTYLTKYDS 139

  Fly   134 NAIDF----FADFNQD------------------------TTWGYATEKPTVFIKLNKVIGYVPE 170
            ||.:.    ..|.|.|                        :.:||.:.||.|.|.||::||:.|.
 Worm   140 NATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPT 204

  Fly   171 TY---DTPDDLPKEAPASL------------QDTVGKLGNTPKIWITCEVTNGPKPEMVFYPGPY 220
            .|   ..|:::.....|..            |:.:||:...|        :||....  :||..:
 Worm   205 DYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMP--------SNGIDGR--YYPYVF 259

  Fly   221 FEASENMRGVTRVVA-IQMNKMPENAKTFFSCKVWARNIPIDDDYQGMGIIKF 272
                  .:|..:.:| ::.:.:|.|......|:.:|.||..|...: :|::.|
 Worm   260 ------TKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSR-LGMVYF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11703NP_650792.1 Na_K-ATPase 32..267 CDD:298651 65/301 (22%)
nkb-1NP_492506.1 Na_K-ATPase 27..303 CDD:278704 66/304 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.