DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11703 and AgaP_AGAP007791

DIOPT Version :9

Sequence 1:NP_650792.1 Gene:CG11703 / 42307 FlyBaseID:FBgn0038690 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_317717.3 Gene:AgaP_AGAP007791 / 1278171 VectorBaseID:AGAP007791 Length:323 Species:Anopheles gambiae


Alignment Length:326 Identity:84/326 - (25%)
Similarity:138/326 - (42%) Gaps:58/326 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPEDVMVPAGDYKLVKQIRRNQETRRKKDLPWSKRIFDIDEHKLFGRTALGWMRITGFYLVLYAL 65
            ||:.|..|...::...:...|:.|.:...|    .:::.:|..:||||...|.:|..||:|.|::
Mosquito     1 MPKPVEEPFDQFQQYYRTPNNRSTAQSFQL----FLWNSEEGAIFGRTPSSWSKIGIFYIVFYSV 61

  Fly    66 IVCIVAFWLGIFMLAIIDPNKPRW-----LKGP-PGLSMVP-----NQNRSVLAYFTHIMSEVNP 119
            :..:||..:.:| ...:||..|:|     |.|. |||...|     |...:::.|..........
Mosquito    62 LAALVAVCMWVF-FQTLDPRIPKWQMDQSLIGTNPGLGFRPLPSEDNVESTLIWYKGTDEKNYKM 125

  Fly   120 IADRIDDFL------NKLNDNAIDFF-ADFNQ--------------------DTTWGYATEKPTV 157
            ..|.:||||      .:::....:.: .|:||                    :..:.|....|.:
Mosquito   126 WTDALDDFLQDYRTPGQVSGRGQNIYNCDYNQPPPKGMVCDVDIKQYGPCTLENHYNYHKSAPCI 190

  Fly   158 FIKLNKVIGYVPETYDTPDDLPKEAPASLQDTV-----GKLGNTPKIWITCEVTNGPKPEMV--- 214
            |:||||:.|:|||.|:....||...|..|:|.:     .:|.....:|::||..|....|.|   
Mosquito   191 FLKLNKIYGWVPEFYNESSSLPSNMPTDLKDYIKEKEQKELHTMNTVWVSCEGENAADIENVGQI 255

  Fly   215 -FYP----GPYFEASENMRG-VTRVVAIQMNKMPENAKTFFSCKVWARNIPIDDDYQGMGIIKFA 273
             :||    ..|:...||..| ::.:||:...:..........||.||.||. .|.::.||.:.|.
Mosquito   256 QYYPRRGFPGYYYPYENSEGYLSPLVAVHFERPVRGIIINIECKAWAHNIK-HDRHERMGTVHFE 319

  Fly   274 L 274
            |
Mosquito   320 L 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11703NP_650792.1 Na_K-ATPase 32..267 CDD:298651 73/286 (26%)
AgaP_AGAP007791XP_317717.3 Na_K-ATPase 26..317 CDD:278704 76/296 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.