Sequence 1: | NP_001262726.1 | Gene: | vib / 42306 | FlyBaseID: | FBgn0267975 | Length: | 273 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005258234.1 | Gene: | LPIN2 / 9663 | HGNCID: | 14450 | Length: | 933 | Species: | Homo sapiens |
Alignment Length: | 232 | Identity: | 45/232 - (19%) |
---|---|---|---|
Similarity: | 76/232 - (32%) | Gaps: | 77/232 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 AEASKENTGGGEGIEVLKN----EPFEDFPLLGGKYNSGQYTYKIYHLQSKVPAYIRLLAPK-GS 85
Fly 86 LEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQHIENDLGTVDNVHELTPDKLKVREIVHIDI 150
Fly 151 ANDPVLPADYKPDEDPTTYQSKKTGR-GPLVGSDW------KKHVNPVMTCYKLVTCEFKWFGLQ 208
Fly 209 TRVENF---------------IQKSERRLFTNFHRQV 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
vib | NP_001262726.1 | SRPBCC_PITPNA-B_like | 2..261 | CDD:176897 | 45/232 (19%) |
LPIN2 | XP_005258234.1 | Lipin_N | 38..143 | CDD:282436 | |
Lipin_mid | 506..596 | CDD:293481 | |||
LNS2 | 674..899 | CDD:285447 | 34/179 (19%) | ||
AF1Q | <913..>932 | CDD:259154 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5083 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |