DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and PAH1

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_013888.1 Gene:PAH1 / 855201 SGDID:S000004775 Length:862 Species:Saccharomyces cerevisiae


Alignment Length:188 Identity:34/188 - (18%)
Similarity:67/188 - (35%) Gaps:54/188 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FSVAEASKENTGGGEGIEVLKNEPFEDFPLLGGKYNSGQYTYKIYHLQSKV----------PAYI 77
            |.:.:.|::.      ::|..||...:.|:   |.:.....|.::.:..:|          |...
Yeast    51 FQILKPSQKK------VQVFINEKLSNMPM---KLSDSGEAYFVFEMGDQVTDVPDELLVSPVMS 106

  Fly    78 RLLAP---------KGSLEIHEEAWNAYPYC-RTIITNPGYMDKNFKIDIYSQHIE--NDLGTVD 130
            ...:|         :|..|...|..|..... :.::..|.::|.|...|..|::.|  ..|...:
Yeast   107 ATSSPPQSPETSILEGGTEGEGEGENENKKKEKKVLEEPDFLDINDTGDSGSKNSETTGSLSPTE 171

  Fly   131 NVHELTPDKLKVREIV------------------HI----DIANDPVLPAD-YKPDED 165
            :.....||.::.|::|                  ||    |...|.:|..: |||:::
Yeast   172 SSTTTPPDSVEERKLVEQRTKNFQQKLNKKLTEIHIPSKLDNNGDLLLDTEGYKPNKN 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 34/188 (18%)
PAH1NP_013888.1 SMP2 1..609 CDD:227415 34/188 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.