DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and LPIN3

DIOPT Version :10

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_011527298.1 Gene:LPIN3 / 64900 HGNCID:14451 Length:908 Species:Homo sapiens


Alignment Length:55 Identity:18/55 - (32%)
Similarity:21/55 - (38%) Gaps:23/55 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 DPV-LP-------ADYKPD-EDPT----------TYQSKKTGRG----PLVGSDW 184
            ||: ||       ||.:|| ||||          |.:||....|    |.....|
Human   293 DPLGLPIQQTEAGADLQPDTEDPTLVGPPLHTPETEESKTQSSGDMGLPPASKSW 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 18/55 (33%)
LPIN3XP_011527298.1 Lipin_N 1..107 CDD:461356
Lipin_mid 439..532 CDD:465292
LNS2 593..874 CDD:462403
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.