DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and Lpin2

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001158357.1 Gene:Lpin2 / 64898 MGIID:1891341 Length:931 Species:Mus musculus


Alignment Length:282 Identity:57/282 - (20%)
Similarity:93/282 - (32%) Gaps:84/282 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIKEFRVTLP-LTVE--------------------EYQVAQLFSVAEASKENTGGGEGIEVLKN 44
            :.::.|:.:|| .|||                    |..:.||....|...|            .
Mouse   564 LSLQVFQKSLPKATVESWVKDKMPKKSGRWWFWRKKESMIKQLPETKEGKSE------------V 616

  Fly    45 EPFEDFPLLGGKYNSGQYTYKIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPGYM 109
            .|..|.|     .|:.:.|       |..||.....:.:||.|: ||:....|.....:::.|..
Mouse   617 PPANDLP-----SNAEEPT-------SARPAENDTSSDEGSQEL-EESIKVDPITVETLSHCGTA 668

  Fly   110 DKNFKIDIYSQHIE----NDLGTVDNVHELTPD---KLKVREIVHIDIANDPVLPADYKPDEDPT 167
            .....:.:.|..|.    :| |..|.|..:|..   ..:....:::...||.|:.:|.    |.|
Mouse   669 SYKKSLRLSSDQIAKLKLHD-GPNDVVFSITTQYQGTCRCAGTIYLWNWNDKVIISDI----DGT 728

  Fly   168 TYQSKKTGR-GPLVGSDWKKH--------VNPVMTCYKLVTCEFKWFGLQTRVENF--------- 214
            ..:|...|: .|.:|.||...        :|.  ..||.:.|..:..|:......:         
Mouse   729 ITKSDALGQILPQLGKDWTHQGIARLYHSINE--NGYKFLYCSARAIGMADMTRGYLHWVNDKGT 791

  Fly   215 ------IQKSERRLFTNFHRQV 230
                  :..|...||:.|||:|
Mouse   792 ILPRGPLMLSPSSLFSAFHREV 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 57/281 (20%)
Lpin2NP_001158357.1 Lipin_N 39..144 CDD:282436
Lipin_mid 504..594 CDD:293481 6/29 (21%)
LNS2 672..897 CDD:285447 31/149 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.