DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and PITPNM2

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_024304866.1 Gene:PITPNM2 / 57605 HGNCID:21044 Length:1435 Species:Homo sapiens


Alignment Length:264 Identity:116/264 - (43%)
Similarity:169/264 - (64%) Gaps:15/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENT-GGGEGIEVLKNEPFEDFPLLGGKYNSGQYTY 64
            |.|||:|:.||:|||||::|||:.:.:.|:..| |.|.|:|:|:|.|:.|.|  ||   |||||:
Human     1 MIIKEYRIPLPMTVEEYRIAQLYMIQKKSRNETYGEGSGVEILENRPYTDGP--GG---SGQYTH 60

  Fly    65 KIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQHIENDLGTV 129
            |:||:...:|::.|.:.||.:|.:.||:||||||.||..|.| :::| |.|||.:.: :.|.|..
Human    61 KVYHVGMHIPSWFRSILPKAALRVVEESWNAYPYTRTRFTCP-FVEK-FSIDIETFY-KTDAGEN 122

  Fly   130 DNVHELTPDKLKVREIVHIDIANDPVLPADYKPDEDPTTYQSKKTGRGPLVGSDW----KKHVNP 190
            .:|..|:|.:.....|..|||..|||...:||.:|||..:||.||.|||| ..:|    ||.|.|
Human   123 PDVFNLSPVEKNQLTIDFIDIVKDPVPHNEYKTEEDPKLFQSTKTQRGPL-SENWIEEYKKQVFP 186

  Fly   191 VMTCYKLVTCEFKWFGLQTRVENFIQKSE-RRLFTNFHRQVFCSTDRWYGLTMEDIRAIEDQTKE 254
            :|..|||...||:::|:|:::|.||..:. ||:....|||.:|..|.||||:||:||.:|.:.:.
Human   187 IMCAYKLCKVEFRYWGMQSKIERFIHDTGLRRVMVRAHRQAWCWQDEWYGLSMENIRELEKEAQL 251

  Fly   255 ELDK 258
            .|.:
Human   252 MLSR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 115/263 (44%)
PITPNM2XP_024304866.1 SRPBCC_PITPNM1-2_like 1..258 CDD:176898 116/264 (44%)
DDHD 718..1048 CDD:308481
LNS2 1194..1325 CDD:197870
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.