DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and pitpnc1a

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_021330482.1 Gene:pitpnc1a / 563621 ZFINID:ZDB-GENE-120104-7 Length:240 Species:Danio rerio


Alignment Length:146 Identity:55/146 - (37%)
Similarity:86/146 - (58%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 FKIDIYSQHIENDLGTVDNVHELTPDKLKVREIVHIDIANDPVLPADYKPDEDPTTYQSKKTGRG 177
            |.|.|.::: |::.|..|::.: |..:.:..|:..:|||.|.:....||..|||..::|:||.||
Zfish    14 FSIHIETKY-EDNKGVNDHIFD-TELRDEETEVCIVDIAYDEIPERYYKESEDPRQFKSQKTSRG 76

  Fly   178 PLVGSDWKKHVNPVMTCYKLVTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGLTM 242
             ::...|:...:|:|..|||||.:|:.:|||||||.|:.|..|.:....|||.|...|.|..:||
Zfish    77 -MLKEGWRDTQDPIMCSYKLVTVKFEVWGLQTRVEQFVHKVVRDVLLLGHRQAFAWVDEWIDMTM 140

  Fly   243 EDIRAIEDQTKEELDK 258
            |::|..|..|:|..:|
Zfish   141 EEVREYERATQEATNK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 55/146 (38%)
pitpnc1aXP_021330482.1 SRPBCC <2..159 CDD:326336 55/146 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D951268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.