DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and pitpnc1l

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001016639.1 Gene:pitpnc1l / 549393 XenbaseID:XB-GENE-5779888 Length:333 Species:Xenopus tropicalis


Alignment Length:257 Identity:102/257 - (39%)
Similarity:155/257 - (60%) Gaps:16/257 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENTGGGEGIEVLKNEPFEDFPLLGGKYNSGQYTYK 65
            |.:||:|:.:|||||||::.||:.:::.|.|.:..|||:||:.|||:|     ...:..||||.|
 Frog     1 MLLKEYRICMPLTVEEYRIGQLYMISKHSHEQSSDGEGVEVIINEPYE-----SAVHGKGQYTEK 60

  Fly    66 IYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQHIENDLGTVD 130
            ..:|..|:||:||...|| ...|.|:|||.|||..|..| ..::.| |:|.|.:: .||:.|:..
 Frog    61 RVYLNRKLPAWIRGFIPK-IFYITEKAWNYYPYTVTEYT-CSFLPK-FQIRIETK-FENNNGSNA 121

  Fly   131 NV--HELTPDKLKVREIVHIDIANDPVLPADYKPDEDPTTYQSKKTGRGPLVGSDWKKHVNPVMT 193
            .|  .:.||:.    ::..:|||.|.:....||..||..::.|.|||||||: .:|::...|:|.
 Frog   122 QVFGDKPTPED----DVCFVDIAADDITEGYYKKSEDLRSFHSVKTGRGPLL-DNWRETSEPIMC 181

  Fly   194 CYKLVTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGLTMEDIRAIEDQTKEE 255
            .||||..:|:.:|.|:|||:|:.|:.|.:....|||.....|.|||:::||:|..|.:.:||
 Frog   182 SYKLVAAKFEVYGFQSRVESFVHKNIRDILLAGHRQAVAWMDEWYGMSLEDVRRFEKKLQEE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 101/256 (39%)
pitpnc1lNP_001016639.1 SRPBCC 2..248 CDD:301327 101/256 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D951268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.