DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and rdgBbeta

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_611248.3 Gene:rdgBbeta / 37011 FlyBaseID:FBgn0027872 Length:273 Species:Drosophila melanogaster


Alignment Length:256 Identity:109/256 - (42%)
Similarity:166/256 - (64%) Gaps:10/256 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IKEFRVTLPLTVEEYQVAQLFSVAEASKENTGGGEGIEVLKNEPFEDFPLLGGKYNSGQYTYKIY 67
            |||:||.:|||||||::.||:.:|..|.|.:..|||:||::|:|.|| |:.|    .||||.|..
  Fly     4 IKEYRVCMPLTVEEYKIGQLYMIARHSLEQSEEGEGVEVVENKPCED-PVHG----KGQYTEKHI 63

  Fly    68 HLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQHIENDLGTVDNV 132
            ||.|::|.:|:.:.|: ...:.|::||.|||..|..| ..::.| ..:.|.:::.:|: |:.:|.
  Fly    64 HLSSRLPYWIQAICPR-VFYVIEKSWNYYPYTLTEYT-CSFIPK-LNVLIKTKYEDNN-GSTENC 124

  Fly   133 HELTPDKLKVREIVHIDIANDPVLPADYKPDEDPTTYQSKKTGRGPLVGSDWKKHVNPVMTCYKL 197
            .:||.|:||||.:.|:|||.|.|....||.:|||..::|:||.||||: ..|::...|:|..||:
  Fly   125 LDLTEDELKVRTVDHLDIAFDEVSAKHYKKEEDPKFFKSEKTNRGPLI-EGWRETDKPIMCSYKV 188

  Fly   198 VTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGLTMEDIRAIEDQTKEELDK 258
            |...|:.:||||:||:|||:..|.:....|||.|...|.|:|:|:||:||.|.|.:.|.::
  Fly   189 VHASFEVWGLQTKVEDFIQRGIREILLLGHRQAFAWVDEWHGMTLEDVRAYERQKQAETNE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 109/256 (43%)
rdgBbetaNP_611248.3 SRPBCC 3..252 CDD:301327 109/256 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455372
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105030at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10658
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.