DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and Pitpnm1

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_038939635.1 Gene:Pitpnm1 / 361694 RGDID:1306710 Length:1263 Species:Rattus norvegicus


Alignment Length:282 Identity:113/282 - (40%)
Similarity:166/282 - (58%) Gaps:35/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENTGG-GEGIEVLKNEPFEDFPLLGGKYNSGQYTY 64
            |.|||:.:.||::::|||||||:.:.:.|:|.:.| |.|:|:|.|.|:.|.|  ||   :||||:
  Rat     1 MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGP--GG---NGQYTH 60

  Fly    65 KIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQHIENDLGTV 129
            |:||:.|.:|.:.|.|.||.:|::.||:||||||.||..|.| :::| |.|:|.:.::. |.|..
  Rat    61 KVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCP-FVEK-FSIEIETYYLP-DGGQQ 122

  Fly   130 DNVHELTPDKLKVREIVHIDIANDPVLPADYKPDEDPTTYQSKKTGRGPLVGSDWKK---HVNPV 191
            .||..|:..:.:.|.:..|||..|.|.|.:||.:|||..|:|.||||||| ..||.:   ...|:
  Rat   123 PNVFNLSGAERRQRILDTIDIVRDAVAPGEYKAEEDPRLYRSVKTGRGPL-ADDWARTAAQTGPL 186

  Fly   192 MTCYKLVTCEFKWFGLQTRVENFIQKSE----------------------RRLFTNFHRQVFCST 234
            |..|||...||:::|:|.::|.||...:                      ||:....|||.:|..
  Rat   187 MCAYKLCKVEFRYWGMQAKIEQFIHDVDKDTEFRERCRLPCNAFGKSTGLRRVMLRAHRQAWCWQ 251

  Fly   235 DRWYGLTMEDIRAIEDQTKEEL 256
            |.|..|:|.||||:|::|...|
  Rat   252 DEWIELSMADIRALEEETARML 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 112/281 (40%)
Pitpnm1XP_038939635.1 SRPBCC_PITPNM1-2_like 1..278 CDD:176898 113/282 (40%)
DDHD 708..898 CDD:397132
LNS2 1042..1173 CDD:197870
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.