DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and Lpin

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001188884.1 Gene:Lpin / 35790 FlyBaseID:FBgn0263593 Length:1089 Species:Drosophila melanogaster


Alignment Length:266 Identity:55/266 - (20%)
Similarity:81/266 - (30%) Gaps:117/266 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 TNPGYMDKNFKIDIYSQHIENDLGTVDNVHELTP-----------------------DKLKVRE- 144
            |:|...|..........:.||....|||:.|||.                       .||.::| 
  Fly   713 TSPDITDPTLSKSDSLVNAENTSALVDNLEELTMASNKSDEPKERYKKSLRLSSAAIKKLNLKEG 777

  Fly   145 IVHIDIA--------------------NDPVLPADYKPDEDPTTYQSKKTGR-GPLVGSDW---- 184
            :..|:.:                    ||.|:.:|.    |.|..:|...|. .|:||.||    
  Fly   778 MNEIEFSVTTAYQGTTRCKCYLFRWKHNDKVVISDI----DGTITKSDVLGHILPMVGKDWAQLG 838

  Fly   185 ------KKHVNPVMTCYKLVTCEFKWFGLQTRVENFIQKSERR----------------LFTNFH 227
                  |...|.    |||:....:..| |:||.....:|.|:                |.:.||
  Fly   839 VAQLFSKIEQNG----YKLLYLSARAIG-QSRVTREYLRSIRQGNVMLPDGPLLLNPTSLISAFH 898

  Fly   228 RQVF----------CSTD------------RWYGLTMEDI---RAI------------EDQTKEE 255
            |:|.          |.:|            ..||..:.|:   ||:            :.:.|.|
  Fly   899 REVIEKKPEQFKIACLSDIRDLFPDKEPFYAGYGNRINDVWAYRAVGIPIMRIFTINTKGELKHE 963

  Fly   256 LDKARQ 261
            |.:..|
  Fly   964 LTQTFQ 969

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 54/264 (20%)
LpinNP_001188884.1 Lipin_N 1..103 CDD:282436
Lipin_mid 562..671 CDD:293481
LNS2 760..985 CDD:285447 44/219 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.