DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and pitpnm3

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_005157718.1 Gene:pitpnm3 / 337272 ZFINID:ZDB-GENE-030131-9216 Length:947 Species:Danio rerio


Alignment Length:172 Identity:37/172 - (21%)
Similarity:59/172 - (34%) Gaps:37/172 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IYHLQSKVPAYIRLLA--PK---GSLEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQHIEND 125
            ::.:.....|.:.::.  ||   |::::... |....|....||....|.|...:...||| ...
Zfish   708 VFSIDGSFAASVSIMGSDPKVRPGAVDVVRH-WQDLGYLIIYITGRPDMQKQRVVSWLSQH-NFP 770

  Fly   126 LGTVDNVHELTPDKLKVREI--------VHIDIANDPVLPADYKPDEDPTTYQSKKTGRGP---- 178
            .|.:.....|..|.|:.:.|        .||.|      ...|...:|.:.|..  .|..|    
Zfish   771 QGMIFFSEGLVHDPLRQKTIFLRNLMQECHIKI------NCAYGSMKDISVYSI--LGLSPNQIY 827

  Fly   179 LVGSDWKKHVNPVMTCYKLVTCEFKWFGLQTRVENFIQKSER 220
            :||...||:.|         .|:|...|....:.: :|.|.|
Zfish   828 IVGRPSKKYQN---------QCQFLSEGYAVHLSS-LQFSHR 859

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 37/172 (22%)
pitpnm3XP_005157718.1 DDHD 359..561 CDD:280937
Peptidase_M14NE-CP-C_like 637..>712 CDD:304370 0/3 (0%)
LNS2 707..837 CDD:197870 30/138 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.