DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and Pitpnm2

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_038945373.1 Gene:Pitpnm2 / 304474 RGDID:1310867 Length:1385 Species:Rattus norvegicus


Alignment Length:266 Identity:117/266 - (43%)
Similarity:173/266 - (65%) Gaps:19/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENT-GGGEGIEVLKNEPFEDFPLLGGKYNSGQYTY 64
            |.|||:|:.||:|||||::|||:.:.:.|:..| |.|.|:|:|:|.|:.|.|  ||   |||||:
  Rat     1 MIIKEYRIPLPMTVEEYRIAQLYMIQKKSRNETYGQGSGVEILENRPYTDGP--GG---SGQYTH 60

  Fly    65 KIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQHIENDLGTV 129
            |:||:...:|.:.|.:.||.:|.:.||:||||||.||..|.| :::| |.|||.:.: :.|.|..
  Rat    61 KVYHVGMHIPGWFRSILPKAALRVVEESWNAYPYTRTRFTCP-FVEK-FSIDIETFY-KTDTGEN 122

  Fly   130 DNVHELTPDKLKVREIVH--IDIANDPVLPADYKPDEDPTTYQSKKTGRGPLVGSDW----KKHV 188
            :||..|:|  ::..:::.  |||..|||.|::||.:|||..:||.||.|||| ..:|    ||.:
  Rat   123 NNVFNLSP--VEKNQLITDIIDIVKDPVTPSEYKTEEDPKLFQSIKTRRGPL-SENWIQEYKKRL 184

  Fly   189 NPVMTCYKLVTCEFKWFGLQTRVENFIQKSE-RRLFTNFHRQVFCSTDRWYGLTMEDIRAIEDQT 252
            .|:|..|||...||:::|:|:::|.||..:. ||:....|||.:|..|.|||||||.||.:|.:.
  Rat   185 LPIMCAYKLCKVEFRYWGMQSKIERFIHDTGLRRVMVRAHRQAWCWQDEWYGLTMEKIRELEKEV 249

  Fly   253 KEELDK 258
            :..|.:
  Rat   250 QLMLSR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 116/265 (44%)
Pitpnm2XP_038945373.1 SRPBCC_PITPNM1-2_like 1..258 CDD:176898 117/266 (44%)
DDHD 704..998 CDD:397132
SMP2 <1041..>1190 CDD:227415
LNS2 1144..1275 CDD:197870
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.