DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and LPIN1

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001248357.1 Gene:LPIN1 / 23175 HGNCID:13345 Length:975 Species:Homo sapiens


Alignment Length:116 Identity:25/116 - (21%)
Similarity:38/116 - (32%) Gaps:36/116 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 NDPVLPADYKPDEDPTTYQSKKTGR-GPLVGSDW------KKHVNPVMTCYKLVTCEFKWFGLQT 209
            :|.|:.:|.    |.|..:|...|. .|.:|.||      |.:.......||.:.|..:..|:..
Human   756 DDKVIISDI----DGTITRSDTLGHILPTLGKDWTHQGIAKLYHKVSQNGYKFLYCSARAIGMAD 816

  Fly   210 RVENFIQKSERR---------------LFTNFHRQVF----------CSTD 235
            ....::.....|               ||:..||:|.          |.||
Human   817 MTRGYLHWVNERGTVLPQGPLLLSPSSLFSALHREVIEKKPEKFKVQCLTD 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 25/116 (22%)
LPIN1NP_001248357.1 Lipin_N 50..155 CDD:282436
Lipin_mid 549..639 CDD:293481
LNS2 711..936 CDD:285447 25/116 (22%)
AF1Q 940..>969 CDD:259154
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.