DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and Pitpnm1

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_032877.1 Gene:Pitpnm1 / 18739 MGIID:1197524 Length:1243 Species:Mus musculus


Alignment Length:261 Identity:113/261 - (43%)
Similarity:165/261 - (63%) Gaps:14/261 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENTGG-GEGIEVLKNEPFEDFPLLGGKYNSGQYTY 64
            |.|||:.:.||::::|||||||:.:.:.|:|.:.| |.|:|:|.|.|:.|.|  ||   :||||:
Mouse     1 MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGP--GG---NGQYTH 60

  Fly    65 KIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQHIENDLGTV 129
            |:||:.|.:|.:.|.|.||.:|::.||:||||||.||..|.| :::| |.|:|.:.::. |.|..
Mouse    61 KVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCP-FVEK-FSIEIETYYLP-DGGQQ 122

  Fly   130 DNVHELTPDKLKVREIVHIDIANDPVLPADYKPDEDPTTYQSKKTGRGPLVGSDWKK---HVNPV 191
            .||..|:..:.:.|.:..|||..|.|.|.:||.:|||..|:|.||||||| ..||.:   ...|:
Mouse   123 PNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYRSAKTGRGPL-ADDWARTAAQTGPL 186

  Fly   192 MTCYKLVTCEFKWFGLQTRVENFIQK-SERRLFTNFHRQVFCSTDRWYGLTMEDIRAIEDQTKEE 255
            |..|||...||:::|:|.::|.||.. ..||:....|||.:|..|.|..|:|.||||:|::|...
Mouse   187 MCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWIELSMADIRALEEETARM 251

  Fly   256 L 256
            |
Mouse   252 L 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 112/260 (43%)
Pitpnm1NP_032877.1 SRPBCC_PITPNM1-2_like 1..257 CDD:176898 113/261 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..330
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 581..679
DDHD 688..878 CDD:280937
Peptidase_M14NE-CP-C_like <963..>995 CDD:304370
LNS2 1022..1153 CDD:197870
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1206..1243
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.