DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and Pitpna

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_032876.1 Gene:Pitpna / 18738 MGIID:99887 Length:271 Species:Mus musculus


Alignment Length:275 Identity:164/275 - (59%)
Similarity:208/275 - (75%) Gaps:14/275 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IKEFRVTLPLTVEEYQVAQLFSVAEASKENTGGGEGIEVLKNEPFEDFPLLGGKYNSGQYTYKIY 67
            :||:||.||::|:||||.||:|||||||..||||||:|||.|||:|...  |.|   ||||:|||
Mouse     4 LKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDD--GEK---GQYTHKIY 63

  Fly    68 HLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQHIENDLGTVDNV 132
            |||||||.::|:|||:|:|.|||:||||||||||:|||. ||.::|.|.|.:.| :.||||.:||
Mouse    64 HLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNE-YMKEDFLIKIETWH-KPDLGTQENV 126

  Fly   133 HELTPDKLKVREIVHIDIAN-DPVLPADYKPDEDPTTYQSKKTGRGPLVGSDWKKH-VN----PV 191
            |:|.|:..|..|.::||||: ..||..|||.:|||..::|.||||||| |.:||:. ||    |.
Mouse   127 HKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSVKTGRGPL-GPNWKQELVNQKDCPY 190

  Fly   192 MTCYKLVTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGLTMEDIRAIEDQTKEEL 256
            |..|||||.:|||:|||.:|||||.|.|:|||||||||:||..|:|..|||:|||.:|::||.:|
Mouse   191 MCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQL 255

  Fly   257 DKARQVGEVRGMRAD 271
            |:.||...|:||.||
Mouse   256 DEMRQKDPVKGMTAD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 157/263 (60%)
PitpnaNP_032876.1 SRPBCC_PITPNA-B_like 3..260 CDD:176897 157/263 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..271 11/20 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 308 1.000 Domainoid score I1336
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 322 1.000 Inparanoid score I2490
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54293
OrthoDB 1 1.010 - - D522789at33208
OrthoFinder 1 1.000 - - FOG0002025
OrthoInspector 1 1.000 - - otm44156
orthoMCL 1 0.900 - - OOG6_103092
Panther 1 1.100 - - O PTHR10658
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4220
SonicParanoid 1 1.000 - - X1329
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.