DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vib and Y71G12B.17

DIOPT Version :9

Sequence 1:NP_001262726.1 Gene:vib / 42306 FlyBaseID:FBgn0267975 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_490879.2 Gene:Y71G12B.17 / 171730 WormBaseID:WBGene00022155 Length:272 Species:Caenorhabditis elegans


Alignment Length:274 Identity:119/274 - (43%)
Similarity:165/274 - (60%) Gaps:7/274 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENTGGGEGIEVLKNEPFEDFPLLGGKYNSGQYTYK 65
            |.:||:|:.|||||:|::...|::|:..|:..||||||:|.|..|.|....|..|:..||.||.|
 Worm     1 MIVKEYRIPLPLTVDEFERGLLYAVSACSRNETGGGEGVEFLVQEDFTSNTLRPGQTVSGTYTKK 65

  Fly    66 IYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQHIENDLGTVD 130
            ||.|:||.|..::.|.|..:..|:||:|||||||:|::||||||..||...|.:.|:: |.|:.:
 Worm    66 IYRLRSKAPWVLQKLLPPEAFVIYEESWNAYPYCKTVLTNPGYMKDNFHQIIETIHLD-DNGSSE 129

  Fly   131 NVHELTPDKLKVREIVHIDIA-NDPVLPADYKPDEDPTTYQSKKTGRGPLVGSDWKKHVNPVMTC 194
            |..: .|:|   ||||.|||| ||.....:|:.::|...::::...|||| ..||....:|||.|
 Worm   130 NPLD-GPEK---REIVFIDIADNDIFGTKNYEKEKDARLFEAETVERGPL-DEDWIDEHDPVMCC 189

  Fly   195 YKLVTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGLTMEDIRAIEDQTKEELDKA 259
            ||||:|.|||.|||..||..:.|...|:|...||..:...|.|:.::||.||..|..|.:.|.|.
 Worm   190 YKLVSCHFKWTGLQRMVEKTVHKQYPRVFGLMHRDAYVLLDNWFNMSMESIREYERATGDILRKQ 254

  Fly   260 RQVGEVRGMRADAD 273
            ....|.||.:.|.|
 Worm   255 LAEPEKRGTKCDDD 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vibNP_001262726.1 SRPBCC_PITPNA-B_like 2..261 CDD:176897 113/259 (44%)
Y71G12B.17NP_490879.2 IP_trans 3..247 CDD:280315 110/249 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5083
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522789at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10658
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.