DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cry and PHR2

DIOPT Version :9

Sequence 1:NP_732407.1 Gene:cry / 42305 FlyBaseID:FBgn0025680 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_182281.1 Gene:PHR2 / 819372 AraportID:AT2G47590 Length:447 Species:Arabidopsis thaliana


Alignment Length:350 Identity:87/350 - (24%)
Similarity:140/350 - (40%) Gaps:74/350 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFIFDGESAGTKNVGYN-----RMRFLL 61
            |.|.|.|:|||:.||:|||..|.:|   .|:.::::||:.||....|..:.|::     |.:||:
plant   112 ALRRAAVVWFRNDLRVHDNECLNSA---NDECVSVLPVYCFDPRDYGKSSSGFDKTGPFRAQFLI 173

  Fly    62 DSLQDIDDQLQAATDGRG-RLLVFEGEPAYIFRRLHEQVRLHRICIEQDCEPIWNERDESIRSLC 125
            :|:.::...|||    || .|:|..|:|..:...|.:::....:...::......:.:..|.:..
plant   174 ESVSELRKNLQA----RGSNLVVRVGKPEAVLVELAKEIGADAVYAHREVSHDEVKAEGKIETAM 234

  Fly   126 RELNID---FVEKVSHTLWDPQLVIETNGGIPPLTYQMFLHTV-------------QIIGLPPRP 174
            :|..::   |.....:.|.|....||.    .|..|..|...|             |:..||.| 
plant   235 KEEGVEVKYFWGSTLYHLDDLPFKIED----LPSNYGAFKDKVQKLEIRKTIAALDQLKSLPSR- 294

  Fly   175 TADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKINWRGGETQALLLL----- 234
             .|..|.|..          ||......|||.....        .|....||||:||..|     
plant   295 -GDVELGDIP----------SLLDLGISPTPRTSQE--------GKPTMVGGETEALTRLKSFAA 340

  Fly   235 DERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFYWSVHDLFKNVQLRACVRG 299
            |.:.::.:...:.|    |.::...:.|.| :|..|..|.:|.|    |:.|..|.. :.|....
plant   341 DCQARLSKGNQKGG----NNSVFGANFSCK-ISPWLAMGSISPR----SMFDELKKT-ISASTTS 395

  Fly   300 VQMTGGAHITG------QLIWREYF 318
            .....|...||      :|:||::|
plant   396 TTPRNGPGDTGLNWLMYELLWRDFF 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cryNP_732407.1 PhrB 4..504 CDD:223492 85/347 (24%)
DNA_photolyase 8..175 CDD:279247 47/188 (25%)
FAD_binding_7 310..510 CDD:281440 4/14 (29%)
PHR2NP_182281.1 PhrB 120..>427 CDD:392275 82/341 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0415
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D378952at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X403
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.