DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31475 and AT5G08580

DIOPT Version :9

Sequence 1:NP_001262725.1 Gene:CG31475 / 42303 FlyBaseID:FBgn0051475 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001332577.1 Gene:AT5G08580 / 830759 AraportID:AT5G08580 Length:391 Species:Arabidopsis thaliana


Alignment Length:421 Identity:99/421 - (23%)
Similarity:152/421 - (36%) Gaps:150/421 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GHNGAQRWPNTLQELEQQQQKHEQSMR--------------LQPVANNLDSRNENN--HRQ---- 126
            |||                |.|...:|              ..|:..:::.|.|:.  .||    
plant    36 GHN----------------QHHRLKLRSSFNFKPTRHDPVPFDPLVADMERRREDKEWERQYIEH 84

  Fly   127 PHPQ----SQKV------QNASKSPNQPETVILAASNVNEKQILAKAFKRADRSRDGILSIQELG 181
            .||:    |||.      ::|....:|||.               :.|..|:             
plant    85 SHPELVSHSQKETTGGGHEHAPGHESQPEW---------------EEFMDAE------------- 121

  Fly   182 QYINRRIVEHIDEAIMNNARE----FRRVDIGPADGLITWDEYHRFFLREHG-----MTEADIDE 237
            .|:|       ||...|....    |.::|:.||||.:|..|...:.::...     .|:.|:|.
plant   122 DYLN-------DEEKFNVTDRLILLFPKIDVSPADGFMTESELTEWTMQSSAKEVVHRTQRDLDV 179

  Fly   238 HD----------EIRHTALNRRAREDMMRDKARW--------SEAARTDLFTLTIDEYLSFRHPE 284
            ||          |....:..|::..:.......|        |:|....|..||  |:..|.||.
plant   180 HDRNKDGFISFSEYEPPSWVRKSDNNSFGYDMGWWKEEHFNASDANGDGLLNLT--EFNDFLHPA 242

  Fly   285 SSVSN--LLELVDDLLRQFDQDGDDQLTLEEF------SDLNVDDDD--------DLMR---KSL 330
            .:.:.  ||.|..:.:|:.|.|.|.:::.|||      :..|.::|:        ||..   |.|
plant   243 DTKNPKLLLWLCKEEVRERDSDKDGKISFEEFFHGLFDTVRNYEEDNHNSTHPYHDLPEGPAKQL 307

  Fly   331 ISKTLVERREEFKRIIDKNHDGKADRGELL---NYVNPKTPRYALQEAATLFSLCDENKDELLTL 392
            .|:            :|||.||.....|||   :.::|....||.|:|..:.|..|.:||..|||
plant   308 FSQ------------LDKNDDGYLSDVELLPIISKIHPTEHYYAKQQADYIISQADSDKDRRLTL 360

  Fly   393 KEMTDHAEIFLQSKMIDTANS-----FHTEF 418
            .||.:|..:| .|.:.|..::     ||.||
plant   361 AEMIEHPYVF-YSAIFDEDDTDDDYGFHDEF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31475NP_001262725.1 EF-hand_7 160..224 CDD:290234 15/67 (22%)
EF-hand_7 296..363 CDD:290234 22/86 (26%)
EFh 301..360 CDD:298682 19/75 (25%)
EFh 344..398 CDD:298682 22/56 (39%)
AT5G08580NP_001332577.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10827
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.