DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31475 and AT4G27790

DIOPT Version :9

Sequence 1:NP_001262725.1 Gene:CG31475 / 42303 FlyBaseID:FBgn0051475 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_194508.1 Gene:AT4G27790 / 828892 AraportID:AT4G27790 Length:345 Species:Arabidopsis thaliana


Alignment Length:350 Identity:80/350 - (22%)
Similarity:141/350 - (40%) Gaps:81/350 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LEQQQQKHEQSM----------RLQ-PVANNLDSRNENNHRQPHPQSQKVQNASKSPNQP-ETVI 148
            |..::|...||:          ||: ||.:.|.:|.|....:....::.|:.|.:..:.. |...
plant    20 LAHKKQNQTQSIEGLITRRIGRRLEMPVFDPLVTRIERLSHEKEAGTKTVEAAKEEKDDMFEEYF 84

  Fly   149 LAASNVNEKQILAKAFKRADRS-RDGILSIQELGQYINRRIVEHIDEAIMNNAREFRRVDIGPAD 212
            .....:|....:...|...|.| |||.:|::||..::.::..   |..:...|:|....| ...|
plant    85 AQERRLNTTMRIKFLFPLLDASPRDGFVSLKELQTWMMQQTE---DNMVYRTAKELELQD-KDKD 145

  Fly   213 GLITWDEYHRFFLREHGMTEADIDEHDEIRHTALNRRAREDMMRDKARWSEAARTDLF----TLT 273
            |:||::||...|.::      ||:::::....|             ..|.|..:...|    :|.
plant   146 GVITFEEYLPQFSKQ------DIEKNEKGHGEA-------------GWWMEQFKNSDFDHNGSLD 191

  Fly   274 IDEYLSFRHPESSVSNLLELVDDLLRQFDQDGDDQ--LTLEEFSDLNVDDDDDLMRKSLISKTLV 336
            |:|:.:|.|||.|                ::||.|  :..|..:.::.:.|..|..|..: |...
plant   192 IEEFNNFLHPEDS----------------RNGDTQRWVLKERMTGMDTNGDGKLEYKEFV-KNAY 239

  Fly   337 ERREEFKRIIDKNHD----------GKADRGE-----------LLNYVNPKTPRYALQEAATLFS 380
            |..:||.: .:|..|          .:.||.:           :|.|:.|....||...:..|..
plant   240 EMYKEFAK-FEKEEDENVPTPQLLFAEMDRDKDRFLVADELRPILQYLQPGEMSYAKFYSTFLCH 303

  Fly   381 LCDENKDELLTLKEMTDHAEIFLQS 405
            ..||:||..|:|:||..|.::|.::
plant   304 EADEDKDGKLSLEEMLHHEDVFYKA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31475NP_001262725.1 EF-hand_7 160..224 CDD:290234 19/64 (30%)
EF-hand_7 296..363 CDD:290234 16/89 (18%)
EFh 301..360 CDD:298682 15/81 (19%)
EFh 344..398 CDD:298682 18/74 (24%)
AT4G27790NP_194508.1 EFh_CREC 95..325 CDD:330175 64/270 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10827
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5438
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.