DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment myd and RCN2

DIOPT Version :10

Sequence 1:NP_732406.1 Gene:myd / 42303 FlyBaseID:FBgn0051475 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001258766.1 Gene:RCN2 / 5955 HGNCID:9935 Length:335 Species:Homo sapiens


Alignment Length:295 Identity:74/295 - (25%)
Similarity:133/295 - (45%) Gaps:59/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 EKQILAKAFKRADRSRDGILSIQELGQYINRRIVEHIDEAIMNNAREFRRVDIGPADGLITWDEY 220
            :::.|....|:.|...||.|:..||..:|......:   |:....::|...|.. :|..:|||||
Human    62 QQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHY---AMQEAKQQFVEYDKN-SDDTVTWDEY 122

  Fly   221 HRFFLREHGMTEADIDEHDEI----RHTALNRRAREDM----------------------MRDKA 259
                         :|..:|.:    .:|||:....|..                      ::||.
Human   123 -------------NIQMYDRVIDFDENTALDDAEEESFRKEFAICKKQSFCFWLLRFNLHLKDKK 174

  Fly   260 RWSEAARTDLFTLTIDEYLSFRHPESSVSNLLE-LVDDLLRQFDQDGDDQLTLEEFS-----DLN 318
            |:.:|.:.....|:::|:::|.||| .|..:.| ::.:.|.:.|::||..::||||.     |..
Human   175 RFEKANQDSGPGLSLEEFIAFEHPE-EVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGDYRWDPT 238

  Fly   319 VDDDDDLMRKSLISKTLVERREEFKRIIDKNHDGKADRGELLNYVNPKTPRYALQEAATLFSLCD 383
            .::|.:.:        ||| ::.|....||::||:.|..|||.:|.|.....|.:||..|....|
Human   239 ANEDPEWI--------LVE-KDRFVNDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMD 294

  Fly   384 ENKDELLTLKEMTDHAEIFLQSKMIDTANSFHTEF 418
            .|.|:.|:.:|:.::.::||.|:..|.....|.::
Human   295 LNGDKKLSEEEILENPDLFLTSEATDYGRQLHDDY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mydNP_732406.1 EFh_CREC 160..403 CDD:330175 69/274 (25%)
EF-hand motif 160..188 CDD:320023 9/27 (33%)
EF-hand motif 198..228 CDD:320023 8/29 (28%)
EF-hand motif 256..285 CDD:320023 9/28 (32%)
EF-hand motif 293..322 CDD:320023 9/33 (27%)
EF-hand motif 338..367 CDD:320023 11/28 (39%)
EF-hand motif 374..403 CDD:320023 8/28 (29%)
RCN2NP_001258766.1 EFh_CREC_RCN2 29..314 CDD:320022 69/278 (25%)
EF-hand motif 29..59 CDD:320022
EF-hand motif 65..94 CDD:320022 9/28 (32%)
EF-hand motif 101..130 CDD:320022 10/42 (24%)
EF-hand motif 171..200 CDD:320022 10/29 (34%)
EF-hand motif 208..237 CDD:320022 8/28 (29%)
EF-hand motif 249..278 CDD:320022 12/29 (41%)
EF-hand motif 285..314 CDD:320022 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.