DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31475 and SDF4

DIOPT Version :9

Sequence 1:NP_001262725.1 Gene:CG31475 / 42303 FlyBaseID:FBgn0051475 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_024303241.1 Gene:SDF4 / 51150 HGNCID:24188 Length:407 Species:Homo sapiens


Alignment Length:306 Identity:87/306 - (28%)
Similarity:146/306 - (47%) Gaps:56/306 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 FKRADRSRDGILSIQELGQYINRRIVEHIDEAIMNNAREFRRVDIGPADGLITWDEYHRFFLREH 228
            |.:.|.:.|..:|.:|:.::|..:..||..||:..:...||.|| ...||.::||||...||...
Human   107 FSKVDVNTDRKISAKEMQRWIMEKTAEHFQEAMEESKTHFRAVD-PDGDGHVSWDEYKVKFLASK 170

  Fly   229 GMTEADIDE----HDEIRHTALNRRAREDMMRDKARW--SEAARTDLFTLTIDEYLSFRHPESSV 287
            |.:|.::.:    ::|::   ::...:|.:...|.||  :::...||. ||.:|:|||.|||.|.
Human   171 GHSEKEVADAIRLNEELK---VDEETQEVLENLKDRWYQADSPPADLL-LTEEEFLSFLHPEHSR 231

  Fly   288 SNLLELVDDLLRQF---------------------------------------------DQDGDD 307
            ..|..:|.:::|..                                             |||||.
Human   232 GMLRFMVKEIVRDLGEAGSSLAGTPGPRTDWQGPGIVGRSGQVLREPQPGCGLTHSRLADQDGDK 296

  Fly   308 QLTLEEFSDLNVDDDDDLMRKSLISKTLVERREEFKRIIDKNHDGKADRGELLNYVNPKTPRYAL 372
            ||::.||..|.|...::...:.:....:.:|::||:.:||.||||.....||.:|::|.....||
Human   297 QLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTAEELESYMDPMNEYNAL 361

  Fly   373 QEAATLFSLCDENKDELLTLKEMTDHAEIFLQSKMIDTANSFHTEF 418
            .||..:.::.|||::..|..:|:..::|.|..||::|.|.|.|.||
Human   362 NEAKQMIAVADENQNHHLEPEEVLKYSEFFTGSKLVDYARSVHEEF 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31475NP_001262725.1 EF-hand_7 160..224 CDD:290234 20/59 (34%)
EF-hand_7 296..363 CDD:290234 23/111 (21%)
EFh 301..360 CDD:298682 21/103 (20%)
EFh 344..398 CDD:298682 19/53 (36%)
SDF4XP_024303241.1 EFh_CREC_cab45 67..392 CDD:320023 78/289 (27%)
EF-hand motif 67..95 CDD:320023
EF-hand motif 102..131 CDD:320023 6/23 (26%)
EF-hand motif 141..170 CDD:320023 12/29 (41%)
EF-hand motif 199..229 CDD:320023 13/30 (43%)
EF-hand motif 237..311 CDD:320023 13/73 (18%)
EF-hand motif 327..356 CDD:320023 13/28 (46%)
EF-hand motif 363..392 CDD:320023 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147157
Domainoid 1 1.000 45 1.000 Domainoid score I12274
eggNOG 1 0.900 - - E1_KOG4251
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32121
Inparanoid 1 1.050 145 1.000 Inparanoid score I4436
Isobase 1 0.950 - 0 Normalized mean entropy S5941
OMA 1 1.010 - - QHG49184
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007325
OrthoInspector 1 1.000 - - oto91297
orthoMCL 1 0.900 - - OOG6_108924
Panther 1 1.100 - - LDO PTHR10827
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3736
SonicParanoid 1 1.000 - - X5438
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.740

Return to query results.
Submit another query.