DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31475 and scf

DIOPT Version :9

Sequence 1:NP_001262725.1 Gene:CG31475 / 42303 FlyBaseID:FBgn0051475 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_477392.1 Gene:scf / 38145 FlyBaseID:FBgn0025682 Length:329 Species:Drosophila melanogaster


Alignment Length:356 Identity:82/356 - (23%)
Similarity:146/356 - (41%) Gaps:86/356 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 QELEQQQQKHEQSMRLQPVANNLDSRNENNHRQPH------PQSQKVQNASKSPNQPETVILAAS 152
            :||.....:|:.   |.|  .:.|. .|:|.:..|      .:|:|..:.:     ||       
  Fly    29 EELPHNPLEHDP---LHP--RHFDG-GEHNAQFDHEAFLGPDESKKFDSLT-----PE------- 75

  Fly   153 NVNEKQILAKAFKRADRSRDGILSIQELGQ---YINRRIVEHIDEAIMNNAREFRRVDIGPA--- 211
              ..::.|.....|.|.::||.:::.||..   |..||.:|.               |:|..   
  Fly    76 --ESRRRLGVIVDRIDENKDGSVTLAELKNWIAYTQRRYIEE---------------DVGRVWKQ 123

  Fly   212 -----DGLITWDEYHRF---FLREHGMTEADIDEHDEIRHTALNRRAREDMMRDKARWSEAARTD 268
                 :..|:||.|.:.   |:.:....|.: .|.:.:.:.:|       :.||:.|||.|.:..
  Fly   124 HNPDNNETISWDSYMQTVYGFMDDLSPDEKE-QEENGVSYKSL-------LKRDRYRWSVADQDL 180

  Fly   269 LFTLTIDEYLSFRHPESSVSN----LLELVDDLLRQFDQDGDDQLTLEEF-SDL----NVDDDDD 324
            ...||.||:.:|.|||...|.    |.|.:.||    |:|.|.:::::|: .|:    ..:|:: 
  Fly   181 DDNLTKDEFTAFLHPEDHPSMKGVVLRETITDL----DKDHDGKISVDEYIGDMYRSTGAEDEE- 240

  Fly   325 LMRKSLISKTLVERREEFKRIIDKNHDGKADRGELLNYVNPKTPRYALQEAATLFSLCDENKDEL 389
                   .:.:...||.|....|.:.||..:..|:..::.|....::..||..|....|.:.|:.
  Fly   241 -------PEWVANEREAFSTHRDLDKDGYLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDK 298

  Fly   390 LTLKEMTDHAEIFLQSKMIDTANSF--HTEF 418
            ||.:|:.|..::|:.|:..|...:.  |.||
  Fly   299 LTKEEILDKYDVFVGSQATDFGEALARHDEF 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31475NP_001262725.1 EF-hand_7 160..224 CDD:290234 17/77 (22%)
EF-hand_7 296..363 CDD:290234 15/71 (21%)
EFh 301..360 CDD:298682 13/63 (21%)
EFh 344..398 CDD:298682 13/53 (25%)
scfNP_477392.1 EF-hand_7 170..227 CDD:290234 21/60 (35%)
EFh 206..273 CDD:238008 17/78 (22%)
EF-hand_7 248..308 CDD:290234 17/59 (29%)
EFh 248..306 CDD:298682 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10827
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.