DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31475 and H10E21.4

DIOPT Version :9

Sequence 1:NP_001262725.1 Gene:CG31475 / 42303 FlyBaseID:FBgn0051475 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_497128.1 Gene:H10E21.4 / 175168 WormBaseID:WBGene00019184 Length:236 Species:Caenorhabditis elegans


Alignment Length:262 Identity:61/262 - (23%)
Similarity:96/262 - (36%) Gaps:82/262 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 AFKRADRSRDGILSIQELGQYINRRIVEHIDEAIMNNAREFRRVDIGPADGLITWDEY-HRFFLR 226
            :|...|.:.||.||.:||..::.:|                     |..||    .|| .||.|.
 Worm    22 SFDLVDANNDGKLSEKELITFMRKR---------------------GRPDG----QEYFQRFDLD 61

  Fly   227 EHG-------------MTEADID-EHDEIRHTALNRRAREDMMRDKARWSEAARTDLFTLTIDEY 277
            .:|             |:...:| :::..:...||    :|.:.|||. .|..|.|         
 Worm    62 RNGHLDISEFVPLVYEMSRRPVDMDYEFFKKMDLN----DDGIVDKAE-VEKIRKD--------- 112

  Fly   278 LSFRHPESSVSNLLELVDDLLRQFDQDGDDQLTLEEFSDLNVDDDDDLMRKSLISKTLVERREEF 342
                       |...::|.:|...|.:.|.|||..||.:          ..|..:|:|....|:.
 Worm   113 -----------NNDRIIDGILSIADTNRDGQLTYAEFKN----------HLSSGAKSLSPAEEQR 156

  Fly   343 KR------IIDKNHDGKADRGELLNY-VNPKTPRYALQEAATLFSLCDENKDELLTLKEMTDHAE 400
            .:      .||.|.|.|.|:.||..: ....|.:....:...:|::.|:|:|..||..|:...|:
 Worm   157 NQALQLLSFIDANGDNKLDQLELYTFSQKTSTNKVTKSDVQQIFAMLDKNQDGYLTENELLQLAQ 221

  Fly   401 IF 402
            .|
 Worm   222 QF 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31475NP_001262725.1 EF-hand_7 160..224 CDD:290234 15/61 (25%)
EF-hand_7 296..363 CDD:290234 20/73 (27%)
EFh 301..360 CDD:298682 18/64 (28%)
EFh 344..398 CDD:298682 16/60 (27%)
H10E21.4NP_497128.1 EF-hand_7 21..75 CDD:290234 18/77 (23%)
EFh 23..72 CDD:238008 18/73 (25%)
EF-hand_7 87..139 CDD:290234 18/76 (24%)
EFh 88..143 CDD:298682 19/89 (21%)
EF-hand_7 161..219 CDD:290234 16/57 (28%)
EFh 166..221 CDD:238008 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.