DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5555 and Hrd1A

DIOPT Version :9

Sequence 1:NP_001262724.1 Gene:CG5555 / 42302 FlyBaseID:FBgn0038686 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_188230.1 Gene:Hrd1A / 820854 AraportID:AT3G16090 Length:492 Species:Arabidopsis thaliana


Alignment Length:187 Identity:42/187 - (22%)
Similarity:66/187 - (35%) Gaps:64/187 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 GYFSGNPI----VEVTKGLIHLYKKNERKAIKEAPSNQLCLLAVPATLNCHDLLNFIAPCHAEIK 179
            |.:...|:    :|:.:.|:||             |..:|...|       ..:|:..|.|    
plant   204 GQWEKKPVYTFYLELIRDLLHL-------------SMYICFFFV-------IFMNYGVPLH---- 244

  Fly   180 HIQIVRDGSPNQFMVLLE-FRSNESALEFYKSYNGSTYNSLE--PDSLCHAVWVSEVERSEHGAP 241
               ::|:        |.| ||:.:..:..|..|...|.|..:  ||:....:..|:.        
plant   245 ---LLRE--------LYETFRNFQIRVSDYLRYRKITSNMNDRFPDATPEELTASDA-------- 290

  Fly   242 PMGHTELPTCPVCLERMDESVDGVLTILCNHAFHASCLMKW--GDSTCPVCRHVQTP 296
                    ||.:|.|.|..:    ..::|.|.||..||..|  ...|||.||.:..|
plant   291 --------TCIICREEMTNA----KKLICGHLFHVHCLRSWLERQQTCPTCRALVVP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5555NP_001262724.1 RRM_BRAP2 150..234 CDD:241162 18/86 (21%)
zf-RING_2 249..291 CDD:290367 15/43 (35%)
zf-UBP 304..363 CDD:280334
CENP-F_leu_zip 366..517 CDD:287450
DUF4200 396..517 CDD:290574
Hrd1ANP_188230.1 HRD1 3..386 CDD:227568 42/187 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.