DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqz and znf362

DIOPT Version :9

Sequence 1:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001072350.1 Gene:znf362 / 779803 XenbaseID:XB-GENE-5793620 Length:403 Species:Xenopus tropicalis


Alignment Length:158 Identity:90/158 - (56%)
Similarity:114/158 - (72%) Gaps:2/158 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 QAKPYKCGSCSKSFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRH 218
            :|||:||..|||||||:|||:||.|||||:|||.|..|::.|.||||||||.|.||||:||||..
 Frog   234 EAKPHKCPHCSKSFANASYLAQHLRIHLGVKPYHCSYCEKSFRQLSHLQQHTRIHTGDRPYKCPQ 298

  Fly   219 AGCPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLKTHICNLCGKS 283
            .||.|||:||||||||.|.|..|||:||.:||:.::|..:|..|:..|. .||.|.:.|::||::
 Frog   299 PGCEKAFTQLSNLQSHQRQHNKDKPYKCPNCYRAYTDSASLQIHLSAHA-IKHAKAYCCSMCGRA 362

  Fly   284 YTQETYLQKHLQKHAEKAEKQQHRHTAQ 311
            ||.||||.||:.||. ..|...:.|:.|
 Frog   363 YTSETYLMKHMSKHT-VVEHLVNHHSPQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 14/19 (74%)
zf-H2C2_2 172..197 CDD:290200 15/24 (63%)
zf-C2H2 186..208 CDD:278523 13/21 (62%)
C2H2 Zn finger 188..208 CDD:275368 12/19 (63%)
zf-C2H2_8 191..271 CDD:292531 45/79 (57%)
zf-H2C2_2 200..227 CDD:290200 19/26 (73%)
C2H2 Zn finger 216..238 CDD:275368 15/21 (71%)
C2H2 Zn finger 246..266 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 11/19 (58%)
znf362NP_001072350.1 C2H2 Zn finger 212..232 CDD:275368
zf-H2C2_2 224..249 CDD:404364 10/14 (71%)
zf-C2H2 238..260 CDD:395048 15/21 (71%)
C2H2 Zn finger 240..260 CDD:275368 14/19 (74%)
zf-H2C2_2 252..277 CDD:404364 15/24 (63%)
C2H2 Zn finger 268..288 CDD:275368 12/19 (63%)
SFP1 <290..342 CDD:227516 30/51 (59%)
C2H2 Zn finger 296..318 CDD:275368 15/21 (71%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 358..376 CDD:275368 10/17 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12078
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.