DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqz and znf362a

DIOPT Version :9

Sequence 1:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001071201.1 Gene:znf362a / 777625 ZFINID:ZDB-GENE-061103-547 Length:448 Species:Danio rerio


Alignment Length:154 Identity:88/154 - (57%)
Similarity:113/154 - (73%) Gaps:3/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 QAKPYKCGSCSKSFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRH 218
            :|||:||..|:|:|||:|||:||.|||||:|||.|..|::.|.||||||||.|.||||:||||..
Zfish   279 EAKPHKCPHCTKTFANASYLAQHLRIHLGVKPYHCSYCEKSFRQLSHLQQHTRIHTGDRPYKCLQ 343

  Fly   219 AGCPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLKTHICNLCGKS 283
            .||.|||:||||||||.|.|..|||:||::||:.:||..:|..|:..|. .|:.|.:.|::||::
Zfish   344 PGCEKAFTQLSNLQSHQRSHNKDKPYKCSNCYRAYSDSASLQIHLSAHA-IKNAKAYCCSMCGRA 407

  Fly   284 YTQETYLQKHLQKH--AEKAEKQQ 305
            ||.||||.||:.||  .|....||
Zfish   408 YTSETYLMKHMSKHTVVEHLVSQQ 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 12/19 (63%)
zf-H2C2_2 172..197 CDD:290200 15/24 (63%)
zf-C2H2 186..208 CDD:278523 13/21 (62%)
C2H2 Zn finger 188..208 CDD:275368 12/19 (63%)
zf-C2H2_8 191..271 CDD:292531 46/79 (58%)
zf-H2C2_2 200..227 CDD:290200 19/26 (73%)
C2H2 Zn finger 216..238 CDD:275368 15/21 (71%)
C2H2 Zn finger 246..266 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..297 CDD:275368 11/19 (58%)
znf362aNP_001071201.1 C2H2 Zn finger 257..277 CDD:275368
zf-H2C2_2 269..294 CDD:290200 8/14 (57%)
C2H2 Zn finger 285..305 CDD:275368 12/19 (63%)
zf-H2C2_2 297..322 CDD:290200 15/24 (63%)
COG5048 309..>403 CDD:227381 53/94 (56%)
C2H2 Zn finger 313..333 CDD:275368 12/19 (63%)
zf-H2C2_2 325..352 CDD:290200 19/26 (73%)
C2H2 Zn finger 341..363 CDD:275368 15/21 (71%)
zf-H2C2_2 355..379 CDD:290200 14/23 (61%)
C2H2 Zn finger 371..391 CDD:275368 7/19 (37%)
C2H2 Zn finger 401..421 CDD:275368 11/19 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12363
eggNOG 1 0.900 - - E33208_3BF42
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25947
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.