DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqz and ZNF79

DIOPT Version :9

Sequence 1:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_009066.2 Gene:ZNF79 / 7633 HGNCID:13153 Length:498 Species:Homo sapiens


Alignment Length:295 Identity:94/295 - (31%)
Similarity:136/295 - (46%) Gaps:49/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 HDYKPFNISEFRQNVAERLDYSLKNGLVQHQQQMVMEQQPHPDQQ------------QQQHLHHP 89
            |..||:..:|..:      .:|..:.|.|||:....| :|:...:            |.|.:|..
Human   188 HRAKPYACNECGK------AFSYCSSLSQHQKSHTGE-KPYECSECGKAFSQSSSLIQHQRIHTG 245

  Fly    90 QQQQHPPQLKVSYSAPNSPPTPHEQQEQKYDPNR-SPPRQQMSSASGSGSN-----GSSPEE--- 145
            ::.....:...::| .|:..|.|::......|.| |...:..|..|....:     |..|.|   
Human   246 EKPYKCSECGRAFS-QNANLTKHQRTHTGEKPYRCSECEKAFSDCSALVQHQRIHTGEKPYECSD 309

  Fly   146 -------------ESRRGDGDQAKPYKCGSCSKSFANSSYLSQHTRIHLGIKPYRCEICQRKFTQ 197
                         ..|...|:  |||||..|.|:|:..:...||.|||.|.|||||..|.:.|:|
Human   310 CGKAFRHSANLTNHQRTHTGE--KPYKCSECGKAFSYCAAFIQHQRIHTGEKPYRCAACGKAFSQ 372

  Fly   198 LSHLQQHIRTHTGDKPYKCRHAGCPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEH 262
            .::|..|.|||||:|||||  :.|.|||||.:||..|.:.|..:||:|||.|.|.||:...|:.|
Human   373 SANLTNHQRTHTGEKPYKC--SECGKAFSQSTNLIIHQKTHTGEKPYKCNECGKFFSESSALIRH 435

  Fly   263 IPKHKDSKHLKTHICNLCGKSYTQETYLQKHLQKH 297
            ...|...   |.:.||.|||::.|.:.|.:|.:.|
Human   436 HIIHTGE---KPYECNECGKAFNQSSSLSQHQRIH 467

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 7/19 (37%)
zf-H2C2_2 172..197 CDD:290200 13/24 (54%)
zf-C2H2 186..208 CDD:278523 9/21 (43%)
C2H2 Zn finger 188..208 CDD:275368 7/19 (37%)
zf-C2H2_8 191..271 CDD:292531 37/79 (47%)
zf-H2C2_2 200..227 CDD:290200 16/26 (62%)
C2H2 Zn finger 216..238 CDD:275368 10/21 (48%)
C2H2 Zn finger 246..266 CDD:275368 8/19 (42%)
C2H2 Zn finger 277..297 CDD:275368 8/19 (42%)
ZNF79NP_009066.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
KRAB 40..98 CDD:214630
KRAB_A-box 40..77 CDD:143639