DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqz and CG14711

DIOPT Version :9

Sequence 1:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster


Alignment Length:203 Identity:60/203 - (29%)
Similarity:96/203 - (47%) Gaps:29/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PHEQQEQKYDPNRSPPRQQMSSASGSGSNGSSPEEESRRGDGDQAKPYKCGSCSKSFANSSYLSQ 175
            |....|::      ||.|        .|..||||..|..        ..|..|...::..:.|:.
  Fly   201 PRSFSEER------PPVQ--------ASFKSSPEVSSTN--------IMCEICGNIYSKRAALNI 243

  Fly   176 HTRIHLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHAGCPKAFSQLSNLQSHSRCHQT 240
            |.|.|:..||::||||.:.|...|.|.:|||.|||:||:.|::  |.::|:..|:...|.|.|..
  Fly   244 HMRRHMAEKPFKCEICSKSFAGPSELNRHIRVHTGEKPFLCKY--CNRSFADRSSNIRHERTHTN 306

  Fly   241 DKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLKTHICNLCGKSYTQETYLQKHL--QKHAEKAEK 303
            ::||.|::|.|.||....|..|:..|...   |..:|.:|.|:::::..|.:||  ..|.:....
  Fly   307 ERPFTCSTCGKAFSYSNVLKNHMLTHTGE---KPFLCRVCNKTFSRKHQLDQHLGTMTHQQTVIH 368

  Fly   304 QQHRHTAQ 311
            .::..|.:
  Fly   369 HKNERTGR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 5/19 (26%)
zf-H2C2_2 172..197 CDD:290200 11/24 (46%)
zf-C2H2 186..208 CDD:278523 10/21 (48%)
C2H2 Zn finger 188..208 CDD:275368 10/19 (53%)
zf-C2H2_8 191..271 CDD:292531 29/79 (37%)
zf-H2C2_2 200..227 CDD:290200 12/26 (46%)
C2H2 Zn finger 216..238 CDD:275368 6/21 (29%)
C2H2 Zn finger 246..266 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..297 CDD:275368 6/21 (29%)
CG14711NP_650094.1 zf-AD 6..81 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 5/19 (26%)
zf-H2C2_2 240..264 CDD:290200 10/23 (43%)
COG5048 249..>362 CDD:227381 41/117 (35%)
C2H2 Zn finger 256..276 CDD:275368 10/19 (53%)
zf-H2C2_2 268..292 CDD:290200 11/25 (44%)
C2H2 Zn finger 284..304 CDD:275368 6/21 (29%)
zf-H2C2_2 299..321 CDD:290200 9/21 (43%)
C2H2 Zn finger 312..332 CDD:275368 7/19 (37%)
zf-H2C2_2 325..349 CDD:290200 7/26 (27%)
C2H2 Zn finger 340..362 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.