DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqz and Blimp-1

DIOPT Version :9

Sequence 1:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster


Alignment Length:480 Identity:137/480 - (28%)
Similarity:187/480 - (38%) Gaps:137/480 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HPDQQQQQHLHHPQQQQHPPQLKVSYSAPNSPPTPHEQQEQKYDPNR-SPPRQQMSSASGSGS-- 138
            |..|...|.|:||..|               |.||    .|:..|.| |||    ||.|..|:  
  Fly   816 HLLQTSTQMLNHPLMQ---------------PLTP----LQRLSPLRISPP----SSLSPDGNSC 857

  Fly   139 --NGS--SPEEESRRG-----------DGDQAKPYKCGSCSKSFANSSYLSQHTRIHLGIKPYRC 188
              :||  ||...:.||           ||..  .|:|..|.|:|...|.|..|.|.|.|.:|::|
  Fly   858 PRSGSPLSPNSLASRGYRSLPYPLKKKDGKM--HYECNVCCKTFGQLSNLKVHLRTHSGERPFKC 920

  Fly   189 EICQRKFTQLSHLQQHIRTHTGDKPYKCRHAGCPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCF 253
            .:|.:.||||:|||:|...|||:||::|..  |.|.||..|||::|.|.|...||:.|:.|.:.|
  Fly   921 NVCTKSFTQLAHLQKHHLVHTGEKPHQCDI--CKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKF 983

  Fly   254 SDEMTLLEHIPKHKDSKHLKTHICNLCGKSYTQETYLQKHLQKHAEKAEKQQHRHTAQVAAHQQH 318
            :..:.|..|...|.:.   :.::|..|.|.|...:.|:.|.:..:.|..                
  Fly   984 TQFVHLKLHKRLHTND---RPYVCQGCDKKYISASGLRTHWKTTSCKPN---------------- 1029

  Fly   319 VPASGIGLNLQRQ-AMNDVNAAYWAKMGADSAAASLAEAIQQQLPQAGGQPYGNFASLQQQHQQQ 382
                    ||:.: ||               |||:.:|.:.:..|             :...::.
  Fly  1030 --------NLEEELAM---------------AAAATSECLDKDHP-------------EPDSREA 1058

  Fly   383 QQELLHHQRLADTPGHSHSPHEEAAGEDLVLRQSTPQ-----HHLQQQQQQQQQQQAQQQQQAQH 442
            .::|..|...|..||..|.   .:.|      ||.|:     :|:..|||..||||.|.|||...
  Fly  1059 YEQLTQHMHPAVHPGLRHL---SSGG------QSPPRLIPLGNHMAPQQQSHQQQQQQHQQQGVP 1114

  Fly   443 QP-------SPGPGNSAFTPLSATVAPPPHLQQHRGPP-----GSAAAYLYQQNAAAAAAAFPTQ 495
            .|       |.||.....|..|....||||.||: .|.     |.|.....||.........|..
  Fly  1115 PPHLLMTQHSVGPAPMLLTTASQLPPPPPHHQQN-SPSRLLQHGHAHPLQMQQQQQQQQQHSPKG 1178

  Fly   496 LISLHQIRNYAHQPGAAGLIAGDHL 520
            |.||.:...|.|         |.|:
  Fly  1179 LKSLPESGVYLH---------GQHV 1194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 8/19 (42%)
zf-H2C2_2 172..197 CDD:290200 9/24 (38%)
zf-C2H2 186..208 CDD:278523 10/21 (48%)
C2H2 Zn finger 188..208 CDD:275368 10/19 (53%)
zf-C2H2_8 191..271 CDD:292531 33/79 (42%)
zf-H2C2_2 200..227 CDD:290200 13/26 (50%)
C2H2 Zn finger 216..238 CDD:275368 10/21 (48%)
C2H2 Zn finger 246..266 CDD:275368 5/19 (26%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 8/19 (42%)
zf-H2C2_2 904..929 CDD:290200 9/24 (38%)
C2H2 Zn finger 920..940 CDD:275368 10/19 (53%)
zf-H2C2_2 932..957 CDD:290200 13/26 (50%)
C2H2 Zn finger 948..968 CDD:275368 10/21 (48%)
zf-H2C2_2 960..985 CDD:290200 10/24 (42%)
C2H2 Zn finger 976..996 CDD:275368 5/19 (26%)
C2H2 Zn finger 1004..1023 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457122
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.