| Sequence 1: | NP_524403.1 | Gene: | sqz / 42300 | FlyBaseID: | FBgn0010768 | Length: | 535 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001261387.1 | Gene: | CG12605 / 38468 | FlyBaseID: | FBgn0035481 | Length: | 619 | Species: | Drosophila melanogaster |
| Alignment Length: | 242 | Identity: | 78/242 - (32%) |
|---|---|---|---|
| Similarity: | 112/242 - (46%) | Gaps: | 60/242 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 82 QQQHLHHPQQ-QQHPPQLKV--------SYSAPNSPPTPHEQQEQKYDPNRSPPRQQMSSASGSG 137
Fly 138 SNGSSPEE-------ESRRGDGDQ-AKP----YKCGSCSKSFANSSYLSQHTRIHLGI------- 183
Fly 184 -----KPY-----------------RCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHAGCPKAFS 226
Fly 227 QLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLK 273 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sqz | NP_524403.1 | C2H2 Zn finger | 160..180 | CDD:275368 | 9/19 (47%) |
| zf-H2C2_2 | 172..197 | CDD:290200 | 10/53 (19%) | ||
| zf-C2H2 | 186..208 | CDD:278523 | 9/38 (24%) | ||
| C2H2 Zn finger | 188..208 | CDD:275368 | 8/19 (42%) | ||
| zf-C2H2_8 | 191..271 | CDD:292531 | 35/79 (44%) | ||
| zf-H2C2_2 | 200..227 | CDD:290200 | 16/26 (62%) | ||
| C2H2 Zn finger | 216..238 | CDD:275368 | 10/21 (48%) | ||
| C2H2 Zn finger | 246..266 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 277..297 | CDD:275368 | |||
| CG12605 | NP_001261387.1 | zf-C2H2 | 439..461 | CDD:278523 | 11/21 (52%) |
| C2H2 Zn finger | 441..461 | CDD:275370 | 9/19 (47%) | ||
| C2H2 Zn finger | 472..492 | CDD:275368 | 2/19 (11%) | ||
| COG5048 | 492..>570 | CDD:227381 | 34/83 (41%) | ||
| zf-C2H2 | 496..518 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 498..518 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 511..534 | CDD:290200 | 15/24 (63%) | ||
| zf-C2H2 | 524..546 | CDD:278523 | 11/23 (48%) | ||
| C2H2 Zn finger | 526..546 | CDD:275368 | 10/21 (48%) | ||
| zf-H2C2_2 | 538..562 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 554..571 | CDD:275368 | 6/20 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45457068 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||