DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqz and znf384a

DIOPT Version :9

Sequence 1:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_005159474.1 Gene:znf384a / 368610 ZFINID:ZDB-GENE-030616-498 Length:596 Species:Danio rerio


Alignment Length:209 Identity:108/209 - (51%)
Similarity:128/209 - (61%) Gaps:9/209 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 QAKPYKCGSCSKSFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRH 218
            :.||:||..|||||||||||:||.|||.|.|||.|..||:.|.||||||||.|.||||:||||.|
Zfish   336 EGKPHKCPHCSKSFANSSYLAQHIRIHSGAKPYTCSYCQKTFRQLSHLQQHNRIHTGDRPYKCVH 400

  Fly   219 AGCPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLKTHICNLCGKS 283
            .||.|||:||||||||.|.|..|||:||::|.:.::|..:|..|:..| ..||.|.:.|.||.:|
Zfish   401 PGCEKAFTQLSNLQSHRRQHNKDKPYKCHNCNRGYTDATSLEVHLTTH-TVKHAKLYSCGLCNRS 464

  Fly   284 YTQETYLQKHLQKHAEKAEKQQHRHTAQVAAHQQHVPASGIGLNLQRQAMNDVNAAYWAKMGADS 348
            ||.||||.||:|||    ........|.|||.|...|..|.|....|.......||    ..|.:
Zfish   465 YTSETYLMKHMQKH----NPDPLTVAAAVAAQQAQNPGQGSGGGSGRGRGRGRGAA----AAAAA 521

  Fly   349 AAASLAEAIQQQLP 362
            |||:.|:|..|..|
Zfish   522 AAAAAAQAQNQNNP 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 15/19 (79%)
zf-H2C2_2 172..197 CDD:290200 15/24 (63%)
zf-C2H2 186..208 CDD:278523 14/21 (67%)
C2H2 Zn finger 188..208 CDD:275368 13/19 (68%)
zf-C2H2_8 191..271 CDD:292531 46/79 (58%)
zf-H2C2_2 200..227 CDD:290200 20/26 (77%)
C2H2 Zn finger 216..238 CDD:275368 16/21 (76%)
C2H2 Zn finger 246..266 CDD:275368 5/19 (26%)
C2H2 Zn finger 277..297 CDD:275368 13/19 (68%)
znf384aXP_005159474.1 C2H2 Zn finger 258..278 CDD:275368
zf-H2C2_2 270..295 CDD:290200
zf-C2H2_8 283..363 CDD:292531 19/26 (73%)
zf-C2H2 284..306 CDD:278523
C2H2 Zn finger 286..306 CDD:275368
COG5048 <310..478 CDD:227381 87/142 (61%)
zf-C2H2 312..334 CDD:278523
C2H2 Zn finger 314..334 CDD:275368
zf-H2C2_2 326..351 CDD:290200 9/14 (64%)
C2H2 Zn finger 342..362 CDD:275368 15/19 (79%)
zf-H2C2_2 354..379 CDD:290200 15/24 (63%)
C2H2 Zn finger 370..390 CDD:275368 13/19 (68%)
zf-H2C2_2 382..409 CDD:290200 20/26 (77%)
C2H2 Zn finger 398..420 CDD:275368 16/21 (76%)
C2H2 Zn finger 428..448 CDD:275368 5/19 (26%)
C2H2 Zn finger 458..478 CDD:275368 13/19 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12363
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25947
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7661
SonicParanoid 1 1.000 - - X6293
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.