Sequence 1: | NP_524403.1 | Gene: | sqz / 42300 | FlyBaseID: | FBgn0010768 | Length: | 535 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005159474.1 | Gene: | znf384a / 368610 | ZFINID: | ZDB-GENE-030616-498 | Length: | 596 | Species: | Danio rerio |
Alignment Length: | 209 | Identity: | 108/209 - (51%) |
---|---|---|---|
Similarity: | 128/209 - (61%) | Gaps: | 9/209 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 154 QAKPYKCGSCSKSFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRH 218
Fly 219 AGCPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLKTHICNLCGKS 283
Fly 284 YTQETYLQKHLQKHAEKAEKQQHRHTAQVAAHQQHVPASGIGLNLQRQAMNDVNAAYWAKMGADS 348
Fly 349 AAASLAEAIQQQLP 362 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sqz | NP_524403.1 | C2H2 Zn finger | 160..180 | CDD:275368 | 15/19 (79%) |
zf-H2C2_2 | 172..197 | CDD:290200 | 15/24 (63%) | ||
zf-C2H2 | 186..208 | CDD:278523 | 14/21 (67%) | ||
C2H2 Zn finger | 188..208 | CDD:275368 | 13/19 (68%) | ||
zf-C2H2_8 | 191..271 | CDD:292531 | 46/79 (58%) | ||
zf-H2C2_2 | 200..227 | CDD:290200 | 20/26 (77%) | ||
C2H2 Zn finger | 216..238 | CDD:275368 | 16/21 (76%) | ||
C2H2 Zn finger | 246..266 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 277..297 | CDD:275368 | 13/19 (68%) | ||
znf384a | XP_005159474.1 | C2H2 Zn finger | 258..278 | CDD:275368 | |
zf-H2C2_2 | 270..295 | CDD:290200 | |||
zf-C2H2_8 | 283..363 | CDD:292531 | 19/26 (73%) | ||
zf-C2H2 | 284..306 | CDD:278523 | |||
C2H2 Zn finger | 286..306 | CDD:275368 | |||
COG5048 | <310..478 | CDD:227381 | 87/142 (61%) | ||
zf-C2H2 | 312..334 | CDD:278523 | |||
C2H2 Zn finger | 314..334 | CDD:275368 | |||
zf-H2C2_2 | 326..351 | CDD:290200 | 9/14 (64%) | ||
C2H2 Zn finger | 342..362 | CDD:275368 | 15/19 (79%) | ||
zf-H2C2_2 | 354..379 | CDD:290200 | 15/24 (63%) | ||
C2H2 Zn finger | 370..390 | CDD:275368 | 13/19 (68%) | ||
zf-H2C2_2 | 382..409 | CDD:290200 | 20/26 (77%) | ||
C2H2 Zn finger | 398..420 | CDD:275368 | 16/21 (76%) | ||
C2H2 Zn finger | 428..448 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 458..478 | CDD:275368 | 13/19 (68%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 43 | 1.000 | Domainoid score | I12363 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm25947 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R7661 |
SonicParanoid | 1 | 1.000 | - | - | X6293 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.030 |