DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqz and sens-2

DIOPT Version :9

Sequence 1:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001285692.1 Gene:sens-2 / 33957 FlyBaseID:FBgn0051632 Length:746 Species:Drosophila melanogaster


Alignment Length:407 Identity:111/407 - (27%)
Similarity:164/407 - (40%) Gaps:103/407 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LGHLTTAQLVHDYKPFN-ISEFRQNVAERLDYSLKN------------GLVQHQQQMVMEQQPHP 78
            |||||::.|.   .||| :...||......|.::..            .:..||.|...:||   
  Fly   353 LGHLTSSGLA---MPFNPLEAMRQGYPPNYDAAMFQRPLFSPALPFFAAVAFHQGQQQQQQQ--- 411

  Fly    79 DQQQQQHL---HHPQQQQHPPQLKVSYSAP-------NS------------------------PP 109
             ||||..|   :||..|::..:|: |...|       ||                        ||
  Fly   412 -QQQQSGLAAGYHPDSQENLFRLR-SLMVPLQSAGQNNSSAAAAAAAAAAAAVGVGVGVGVGVPP 474

  Fly   110 T------PHEQQEQKYD--PNRSPPRQQMS---SASGSGSNGSSP---EEESRRGDGDQAKPYKC 160
            .      ||......:.  ..:.|...|.|   |........|:|   |..|||....: |||.|
  Fly   475 NGGHLGLPHSPHLHHFHHMAAKWPGLHQFSDLYSCMKCEKMFSTPHGLEVHSRRTHHGK-KPYAC 538

  Fly   161 GSCSKSFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHAGCPKAF 225
            ..|:|:|.:...||||..:|...|.:.|:.|.::|.:.|.|..|:..|:..:||.|.:  |.|.|
  Fly   539 ELCNKTFGHEVSLSQHRAVHNVEKVFECKQCGKRFKRSSTLSTHLLIHSDTRPYPCNY--CGKRF 601

  Fly   226 SQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLKTHICNLCGKSYTQETYL 290
            .|.|:::.|:..|..:||.||..|.|.||....|:.|..||...|...   |.||.|::.::..|
  Fly   602 HQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGYKPFS---CKLCHKAFQRKVDL 663

  Fly   291 QKHLQKHAEKAEKQQHRHTAQVAAHQQHVPASGIGLNLQRQAMNDVNAAYWAKMGAD-SAAASLA 354
            ::|          ::.:||               .|.:....::.::||..|...|: ||||:.|
  Fly   664 RRH----------KETQHT---------------DLRVHLGKVDFMSAAAAAAASAELSAAAAAA 703

  Fly   355 EAIQQQLPQAGGQPYGN 371
            .|....:|  ||.|.|:
  Fly   704 AAAGGSVP--GGGPPGS 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 8/19 (42%)
zf-H2C2_2 172..197 CDD:290200 9/24 (38%)
zf-C2H2 186..208 CDD:278523 6/21 (29%)
C2H2 Zn finger 188..208 CDD:275368 6/19 (32%)
zf-C2H2_8 191..271 CDD:292531 28/79 (35%)
zf-H2C2_2 200..227 CDD:290200 9/26 (35%)
C2H2 Zn finger 216..238 CDD:275368 7/21 (33%)
C2H2 Zn finger 246..266 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
sens-2NP_001285692.1 COG5048 <504..672 CDD:227381 57/183 (31%)
C2H2 Zn finger 509..530 CDD:275368 6/20 (30%)
zf-H2C2_2 522..545 CDD:290200 10/23 (43%)
C2H2 Zn finger 538..558 CDD:275368 8/19 (42%)
zf-H2C2_2 550..575 CDD:290200 9/24 (38%)
C2H2 Zn finger 566..586 CDD:275368 6/19 (32%)
zf-H2C2_2 579..603 CDD:290200 9/25 (36%)
C2H2 Zn finger 594..614 CDD:275368 7/21 (33%)
zf-H2C2_2 606..631 CDD:290200 9/24 (38%)
C2H2 Zn finger 622..642 CDD:275368 7/19 (37%)
zf-H2C2_2 634..657 CDD:290200 9/25 (36%)
C2H2 Zn finger 650..677 CDD:275368 9/51 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.