DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqz and Cf2

DIOPT Version :9

Sequence 1:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster


Alignment Length:243 Identity:79/243 - (32%)
Similarity:104/243 - (42%) Gaps:54/243 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QHQQQMVMEQQPH--PDQQQQQHLHHPQQQQH----------PP-QLKVSYSAPNSPPTPHEQQE 116
            |.|||.::|||..  .:|.|||.:||.||.|.          || .:|::.:|.......|.|..
  Fly   248 QQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKNANGGAIVSHPQVI 312

  Fly   117 QKYDPNRSPPRQQMSSASGSG------------SNGSSPEEESRRG--DGDQAKP--------YK 159
            .|.:|         .|.|.||            :|...|...| .|  .|.|..|        :|
  Fly   313 IKEEP---------LSLSDSGDVVNSVPVYAIQANPGVPAPAS-SGVLVGTQTVPADLAHKIRHK 367

  Fly   160 CGSCSKSFANSSYLSQHTRIHLG-------IKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCR 217
            |..|.|:|.....|:.|.:||.|       .:||.|..|.:.|||.:.|:||.|.|||:||:.|.
  Fly   368 CPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCG 432

  Fly   218 HAGCPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPK 265
            :  |.|:||....|..|.|.|..:||:.|..|.|.|:....|..|..|
  Fly   433 Y--CEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTK 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 6/19 (32%)
zf-H2C2_2 172..197 CDD:290200 10/31 (32%)
zf-C2H2 186..208 CDD:278523 10/21 (48%)
C2H2 Zn finger 188..208 CDD:275368 9/19 (47%)
zf-C2H2_8 191..271 CDD:292531 31/75 (41%)
zf-H2C2_2 200..227 CDD:290200 13/26 (50%)
C2H2 Zn finger 216..238 CDD:275368 8/21 (38%)
C2H2 Zn finger 246..266 CDD:275368 7/20 (35%)
C2H2 Zn finger 277..297 CDD:275368
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 41/108 (38%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
C2H2 Zn finger 403..423 CDD:275368 9/19 (47%)
C2H2 Zn finger 431..451 CDD:275368 8/21 (38%)
zf-H2C2_2 443..468 CDD:316026 10/24 (42%)
C2H2 Zn finger 459..480 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.