DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqz and CG1529

DIOPT Version :9

Sequence 1:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:523 Identity:101/523 - (19%)
Similarity:176/523 - (33%) Gaps:150/523 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PNGVPSG--DYLHRSI---DQLRSLGHLTTAQLVHDYKPFNISEFRQNVAERLDYSLKNGLVQHQ 67
            |:|.|:.  :..|.::   |:||.:...::.:|: .::|.:|:..|.. .|..|..||....:::
  Fly    47 PHGFPTEICNLCHNAVVYFDELRQVARESSQKLI-GWQPVDIAVDRVK-EEPPDEGLKENHEENE 109

  Fly    68 QQMVMEQQPHPDQQQQQHLHHPQQQQHPPQLKVSYSAPNSPPTPHEQQEQKYDPNRSPPRQQMSS 132
            .::..|.:...|.||.. |...|:.|.    |:.          .::::::|.......:||:|.
  Fly   110 HELEEEHEKQADGQQVD-LSKKQEDQK----KIL----------DDREDEEYPDEYENSQQQLSQ 159

  Fly   133 ASGSGSNGSSP--------------EEESRRGDGDQAKPYKCGSCSKSFANSSYLSQHTR----- 178
            .:||.......              |...|......:||:.|.||.|||.....|..|.|     
  Fly   160 GTGSKRRAGLACDQCGKQVYKLPYLEAHIRSVHQGYSKPFLCRSCDKSFTRYEQLRSHMRNAHPQ 224

  Fly   179 ---IHLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHAG-------------------- 220
               :...::...||:|.|:::..:.|.:|::.|...|.:.|.|.|                    
  Fly   225 LEQLQQELRDLICELCNRQYSTKNALGEHLKRHAQRKEHVCEHCGVAKVTRTELLTHLRTHNPTW 289

  Fly   221 -------CPKAFSQLSNLQSHSR-CHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDS------KH 271
                   ||:.|...|.:..|.| .|:..:.|:|..|.|.|....:.:.|...|.:|      ..
  Fly   290 ERFKCEQCPQLFRHKSAISRHVRVVHEGQRRFQCGHCEKKFGTHASQVRHERLHTESTGSGEAAE 354

  Fly   272 LKTHICNLCGKSYTQETYLQKHLQKH-AEKAEKQQHRHTAQVAAHQQHVPASGIGLNLQRQAMND 335
            .....|..|.|.......|:.||::| |.|..:::..|:                          
  Fly   355 EWPFACIHCQKPCVSRQTLELHLRRHRARKTHRKRREHS-------------------------- 393

  Fly   336 VNAAYWAKMGADSAAASLAEAIQQQLPQAGGQPYGNFASLQQQHQQQQQELLHHQRLADTPGHSH 400
                                                     ::.|:|:||   |.|..:......
  Fly   394 -----------------------------------------RESQEQEQE---HDRDQEQGAREA 414

  Fly   401 SPHEEAAGEDLVLRQSTPQHHLQQQQQQQQQQQAQ-QQQQAQHQPSPGPGNSAFTPLSATVAPPP 464
            ...:...||.|..|..:.:.|..:...|..|:..: ||.|..:.|.|.|..::...|....|..|
  Fly   415 QQDQLRKGEKLRQRDLSRESHRNEVTMQTSQRPNECQQGQESYDPEPDPLEASQCKLEQEDALDP 479

  Fly   465 HLQ 467
            ..|
  Fly   480 EWQ 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 9/27 (33%)
zf-H2C2_2 172..197 CDD:290200 7/32 (22%)
zf-C2H2 186..208 CDD:278523 6/21 (29%)
C2H2 Zn finger 188..208 CDD:275368 6/19 (32%)
zf-C2H2_8 191..271 CDD:292531 24/113 (21%)
zf-H2C2_2 200..227 CDD:290200 10/53 (19%)
C2H2 Zn finger 216..238 CDD:275368 9/49 (18%)
C2H2 Zn finger 246..266 CDD:275368 5/19 (26%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 7/31 (23%)
C2H2 Zn finger 171..192 CDD:275368 2/20 (10%)
zf-C2H2_2 201..>257 CDD:289522 15/55 (27%)
C2H2 Zn finger 201..222 CDD:275368 9/20 (45%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 265..285 CDD:275368 3/19 (16%)
zf-C2H2_8 268..349 CDD:292531 16/80 (20%)
C2H2 Zn finger 294..315 CDD:275368 6/20 (30%)
C2H2 Zn finger 323..343 CDD:275368 5/19 (26%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.