DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqz and erm

DIOPT Version :9

Sequence 1:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster


Alignment Length:488 Identity:130/488 - (26%)
Similarity:188/488 - (38%) Gaps:106/488 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HPDQQQQQHLHHP----------QQQQHPPQLKVSYSAPNSPPTPHEQQEQKYDPN----RS--- 124
            |..|..:::|.||          .|.|..|.|:  ::...||......|......|    ||   
  Fly   211 HHSQSLRRNLGHPLAAAAAVAAVAQSQAVPNLQ--HTLEKSPVAQRTAQSSGLQANLKRKRSPQD 273

  Fly   125 ------PPRQQMSSASGSGSNGSSPE---EESRRGDGDQAKP--YKCGSCSKSFANSSY-LSQHT 177
                  ||....:||:|:.|...||:   |:|..|.....||  :.|..|.|.| |:.| |::|.
  Fly   274 QGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTFSCLECGKVF-NAHYNLTRHM 337

  Fly   178 RIHLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCR------------------HAG---- 220
            .:|.|.:|:.|::|.:.|.|.|.|.:|...||.:||:||:                  |||    
  Fly   338 PVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSSTLNTHSRIHAGYKPF 402

  Fly   221 ----CPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLKTHICNLCG 281
                |.|.|.|..|.::|...|..:|.:|||.|.|.|.....|..|:..|.|.   |.:.|.:|.
  Fly   403 VCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFHMHTHNDK---KPYTCRVCA 464

  Fly   282 KSYTQETYLQKHLQKHAE-----------KAEKQQHRHTAQVAAHQQHVPASGIGLNLQRQAMND 335
            |.:.:...|:||::|..|           ....::..:|      ::...|||.|     ||.  
  Fly   465 KGFCRNFDLKKHMRKLHEIGGDLDDLDMPPTYDRRREYT------RREPLASGYG-----QAS-- 516

  Fly   336 VNAAYWAKMGADSAAASLAEAIQQQLPQAGGQPYGNFASLQQQHQQQQQELLHHQRLADTPGHSH 400
                  .::..||::.|::..|....|........|.|..:....|......||| |...|    
  Fly   517 ------GQLTPDSSSGSMSPPINVTTPPLSSGETSNPAWPRSAVSQYPPGGFHHQ-LGVAP---- 570

  Fly   401 SPHEEAAGEDLVLRQSTPQH-HLQQQQQQQQQQQ------AQQQQQAQHQPSPGPGNSAFTPLSA 458
             ||:..:|...:  |..||. |.|.||..||||:      |:...|..:..|......:.:..|:
  Fly   571 -PHDYPSGSAFL--QLQPQQPHPQSQQHHQQQQRLSETFIAKVFXQRYYAESLNSSTGSTSTTSS 632

  Fly   459 TVAPPPHLQQHRGPPGSAAAYLYQQNAAAAAAA 491
            ||..............|.......|..||||||
  Fly   633 TVTTTTTAISSMATSRSDLLIDXLQFVAAAAAA 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 8/20 (40%)
zf-H2C2_2 172..197 CDD:290200 9/25 (36%)
zf-C2H2 186..208 CDD:278523 7/21 (33%)
C2H2 Zn finger 188..208 CDD:275368 7/19 (37%)
zf-C2H2_8 191..271 CDD:292531 33/105 (31%)
zf-H2C2_2 200..227 CDD:290200 14/52 (27%)
C2H2 Zn finger 216..238 CDD:275368 10/47 (21%)
C2H2 Zn finger 246..266 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
ermNP_001259891.2 COG5048 <295..461 CDD:227381 53/169 (31%)
C2H2 Zn finger 320..340 CDD:275368 8/20 (40%)
zf-H2C2_2 332..357 CDD:290200 8/24 (33%)
zf-C2H2 346..368 CDD:278523 7/21 (33%)
C2H2 Zn finger 348..368 CDD:275368 7/19 (37%)
zf-H2C2_2 363..385 CDD:290200 7/21 (33%)
C2H2 Zn finger 376..396 CDD:275368 1/19 (5%)
zf-H2C2_2 389..413 CDD:290200 6/23 (26%)
C2H2 Zn finger 404..424 CDD:275368 6/19 (32%)
zf-H2C2_2 416..441 CDD:290200 10/24 (42%)
C2H2 Zn finger 432..452 CDD:275368 7/19 (37%)
C2H2 Zn finger 460..478 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4043
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.