DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqz and SPAC25B8.19c

DIOPT Version :9

Sequence 1:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_594479.2 Gene:SPAC25B8.19c / 2542738 PomBaseID:SPAC25B8.19c Length:522 Species:Schizosaccharomyces pombe


Alignment Length:187 Identity:47/187 - (25%)
Similarity:75/187 - (40%) Gaps:17/187 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VQHQQQMVMEQQPHPDQQQQQHLHHPQQQQHPPQLKVSYSAPNSPPTPHEQQEQKYDPN---RSP 125
            :.|......|........|......|....:|    ||...||.....|......|.|:   :..
pombe   339 LNHANGNQAENASESSTSQSNDSQGPANTSYP----VSVPLPNDAENNHTLSRNPYIPSLNFKDN 399

  Fly   126 PRQQMSSASGSGSNGSSPEEESRRGDGD---------QAKPYKCGSCSKSFANSSYLSQHTRIHL 181
            ...::|..:...||.:......::.|.:         :|...:..|.|:..|.|...|..|....
pombe   400 MSAELSVVATLASNSAQAHPMGQQSDSNYSDHHNNDKRAHVSRRHSTSRKIAQSHTGSSSTSSAA 464

  Fly   182 GIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHAGCPKAFSQLSNLQSHSRCH 238
            .:: |||..|.:.|::.|.|:.|..:|||::|:.|.:|||.|||:..||::.|.|.|
pombe   465 NVR-YRCTECLQGFSRPSSLKIHTYSHTGERPFVCDYAGCGKAFNVRSNMRRHQRIH 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 6/19 (32%)
zf-H2C2_2 172..197 CDD:290200 7/24 (29%)
zf-C2H2 186..208 CDD:278523 8/21 (38%)
C2H2 Zn finger 188..208 CDD:275368 6/19 (32%)
zf-C2H2_8 191..271 CDD:292531 21/48 (44%)
zf-H2C2_2 200..227 CDD:290200 13/26 (50%)
C2H2 Zn finger 216..238 CDD:275368 11/21 (52%)
C2H2 Zn finger 246..266 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
SPAC25B8.19cNP_594479.2 C2H2 Zn finger 470..490 CDD:275368 6/19 (32%)
zf-H2C2_2 482..508 CDD:290200 12/25 (48%)
C2H2 Zn finger 498..520 CDD:275368 11/21 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.