DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqz and klf-3

DIOPT Version :9

Sequence 1:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001022205.1 Gene:klf-3 / 191713 WormBaseID:WBGene00003480 Length:315 Species:Caenorhabditis elegans


Alignment Length:269 Identity:63/269 - (23%)
Similarity:100/269 - (37%) Gaps:84/269 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PHPDQQQQQHLHHPQQQ-----------------QHPP--QLKVSYSAPNSPPTPHEQQEQKYDP 121
            |:|..:|...:|.|.::                 .|||  |...|||.|::||:.....|..|.|
 Worm    50 PNPGAKQFAPIHVPGREPPRMLLPPTPHFQAPFSPHPPPVQQVPSYSPPHAPPSYETYPEVYYPP 114

  Fly   122 --------------------------------NRSPPRQQMSSASGSGSNGSSPEEES------- 147
                                            :.:||..::.:...|..|...|....       
 Worm   115 HIICNPYDVPTTSDRNPPYYTEVTTVSAVTLHSMTPPTHKIETPPSSPENSFGPLASQLPAIKME 179

  Fly   148 -------RRG--DGDQAKPYKCGSCSKS-FANSSYLSQHTR--------IHLGIKPYRCEICQRK 194
                   ..|  |..::.|....|..:| ....|.:..:.|        :|....|.    |.:|
 Worm   180 IPMHPLPHNGELDSTRSSPSSTTSSERSPLQRKSRIESNKRNPTDKKFVVHACTYPG----CFKK 240

  Fly   195 FTQLSHLQQHIRTHTGDKPYKCRHAGCPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCF--SDEM 257
            :::.|||:.|.|||:|:||:.|:...|...|::...|..|.|.|..||||:|:.|.:.|  ||.:
 Worm   241 YSKSSHLKAHERTHSGEKPFVCKWQNCSWKFARSDELTRHMRKHTGDKPFRCSLCDRNFARSDHL 305

  Fly   258 TLLEHIPKH 266
            :|  |:.:|
 Worm   306 SL--HMKRH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 4/28 (14%)
zf-H2C2_2 172..197 CDD:290200 5/32 (16%)
zf-C2H2 186..208 CDD:278523 7/21 (33%)
C2H2 Zn finger 188..208 CDD:275368 7/19 (37%)
zf-C2H2_8 191..271 CDD:292531 31/78 (40%)
zf-H2C2_2 200..227 CDD:290200 12/26 (46%)
C2H2 Zn finger 216..238 CDD:275368 6/21 (29%)
C2H2 Zn finger 246..266 CDD:275368 7/21 (33%)
C2H2 Zn finger 277..297 CDD:275368
klf-3NP_001022205.1 C2H2 Zn finger 235..254 CDD:275368 8/22 (36%)
C2H2 Zn finger 262..284 CDD:275368 6/21 (29%)
zf-H2C2_2 276..301 CDD:290200 11/24 (46%)
C2H2 Zn finger 292..312 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.