Sequence 1: | NP_524403.1 | Gene: | sqz / 42300 | FlyBaseID: | FBgn0010768 | Length: | 535 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001022205.1 | Gene: | klf-3 / 191713 | WormBaseID: | WBGene00003480 | Length: | 315 | Species: | Caenorhabditis elegans |
Alignment Length: | 269 | Identity: | 63/269 - (23%) |
---|---|---|---|
Similarity: | 100/269 - (37%) | Gaps: | 84/269 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 PHPDQQQQQHLHHPQQQ-----------------QHPP--QLKVSYSAPNSPPTPHEQQEQKYDP 121
Fly 122 --------------------------------NRSPPRQQMSSASGSGSNGSSPEEES------- 147
Fly 148 -------RRG--DGDQAKPYKCGSCSKS-FANSSYLSQHTR--------IHLGIKPYRCEICQRK 194
Fly 195 FTQLSHLQQHIRTHTGDKPYKCRHAGCPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCF--SDEM 257
Fly 258 TLLEHIPKH 266 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sqz | NP_524403.1 | C2H2 Zn finger | 160..180 | CDD:275368 | 4/28 (14%) |
zf-H2C2_2 | 172..197 | CDD:290200 | 5/32 (16%) | ||
zf-C2H2 | 186..208 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 188..208 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2_8 | 191..271 | CDD:292531 | 31/78 (40%) | ||
zf-H2C2_2 | 200..227 | CDD:290200 | 12/26 (46%) | ||
C2H2 Zn finger | 216..238 | CDD:275368 | 6/21 (29%) | ||
C2H2 Zn finger | 246..266 | CDD:275368 | 7/21 (33%) | ||
C2H2 Zn finger | 277..297 | CDD:275368 | |||
klf-3 | NP_001022205.1 | C2H2 Zn finger | 235..254 | CDD:275368 | 8/22 (36%) |
C2H2 Zn finger | 262..284 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 276..301 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 292..312 | CDD:275368 | 7/21 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |