Sequence 1: | NP_524403.1 | Gene: | sqz / 42300 | FlyBaseID: | FBgn0010768 | Length: | 535 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510462.2 | Gene: | egrh-1 / 181580 | WormBaseID: | WBGene00007772 | Length: | 461 | Species: | Caenorhabditis elegans |
Alignment Length: | 318 | Identity: | 75/318 - (23%) |
---|---|---|---|
Similarity: | 119/318 - (37%) | Gaps: | 100/318 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 TAPNGVPSGDYLHRSIDQLRSLGHLTTAQLVHDYKPFNISEFRQNVAER-----LDYSLKNGLVQ 65
Fly 66 HQQ-----------QMVMEQQPHPD----------QQQQQHL------HHPQQQQHP----PQLK 99
Fly 100 -------VSYSAPNSPPTPHEQQEQKYDPNRS--------------------PPRQQMSSASGSG 137
Fly 138 SNG-------SSPEEESRRGDGD---------QAKPYKC--GSCSKSFANSSYLSQHTRIHLGIK 184
Fly 185 PYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHAGCPKAFSQLSNLQSHSRCHQTDK 242 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sqz | NP_524403.1 | C2H2 Zn finger | 160..180 | CDD:275368 | 7/21 (33%) |
zf-H2C2_2 | 172..197 | CDD:290200 | 13/24 (54%) | ||
zf-C2H2 | 186..208 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 188..208 | CDD:275368 | 9/19 (47%) | ||
zf-C2H2_8 | 191..271 | CDD:292531 | 19/52 (37%) | ||
zf-H2C2_2 | 200..227 | CDD:290200 | 13/26 (50%) | ||
C2H2 Zn finger | 216..238 | CDD:275368 | 4/21 (19%) | ||
C2H2 Zn finger | 246..266 | CDD:275368 | |||
C2H2 Zn finger | 277..297 | CDD:275368 | |||
egrh-1 | NP_510462.2 | zf-C2H2 | 374..398 | CDD:278523 | 9/23 (39%) |
C2H2 Zn finger | 376..398 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 390..415 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 406..426 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 418..443 | CDD:290200 | 13/26 (50%) | ||
C2H2 Zn finger | 434..454 | CDD:275368 | 4/21 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |