DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqz and Zfp384

DIOPT Version :9

Sequence 1:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_038962888.1 Gene:Zfp384 / 171018 RGDID:708346 Length:680 Species:Rattus norvegicus


Alignment Length:321 Identity:123/321 - (38%)
Similarity:150/321 - (46%) Gaps:105/321 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KPYKCGSCSKSFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHAG 220
            ||:||..|||:|||:|||:||.|||.|.|||.|..||:.|.||||||||.|.||||:||||.|.|
  Rat   415 KPHKCPHCSKTFANTSYLAQHLRIHSGAKPYNCSYCQKAFRQLSHLQQHTRIHTGDRPYKCAHPG 479

  Fly   221 CPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLKTHICNLCGKSYT 285
            |.|||:||||||||.|.|..||||||::|::.::|..:|..|:..| ..||.|.:.|.:|.::||
  Rat   480 CEKAFTQLSNLQSHRRQHNKDKPFKCHNCHRAYTDAASLEAHLSTH-TVKHAKVYTCTICSRAYT 543

  Fly   286 QETYLQKHLQKHAEKAEKQQHRHTAQVAAHQQHVPASGIGLNLQRQAMNDVNAAYWAKMGADSAA 350
            .||||.||::||                    :.|      :||:|..                |
  Rat   544 SETYLMKHMRKH--------------------NPP------DLQQQVQ----------------A 566

  Fly   351 ASLAEAIQQQLPQAGGQPYGNFASLQQQHQQQQQELLHHQRLADTPGHSHSPHEEAAGEDLVLRQ 415
            |:.|.|:.|...||..|     |..|.|.|.|.|                               
  Rat   567 AAAAAAVAQAQAQAQAQ-----AQAQAQAQAQAQ------------------------------- 595

  Fly   416 STPQHHLQQQQQQQQQQQAQQQQQAQHQPSPGPGNSAFTPLSATVAPPPHLQQHRGPPGSA 476
                   .|.|.|.|..||.||||.|..|.|               .|||.|.    ||:|
  Rat   596 -------AQAQAQAQASQASQQQQQQQPPPP---------------QPPHFQS----PGAA 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 13/19 (68%)
zf-H2C2_2 172..197 CDD:290200 15/24 (63%)
zf-C2H2 186..208 CDD:278523 14/21 (67%)
C2H2 Zn finger 188..208 CDD:275368 13/19 (68%)
zf-C2H2_8 191..271 CDD:292531 47/79 (59%)
zf-H2C2_2 200..227 CDD:290200 20/26 (77%)
C2H2 Zn finger 216..238 CDD:275368 16/21 (76%)
C2H2 Zn finger 246..266 CDD:275368 5/19 (26%)
C2H2 Zn finger 277..297 CDD:275368 10/19 (53%)
Zfp384XP_038962888.1 C2H2 Zn finger 330..350 CDD:275368
COG5048 <353..508 CDD:227381 65/92 (71%)
C2H2 Zn finger 358..378 CDD:275368
C2H2 Zn finger 386..406 CDD:275368
C2H2 Zn finger 419..439 CDD:275368 13/19 (68%)
C2H2 Zn finger 447..467 CDD:275368 13/19 (68%)
C2H2 Zn finger 475..497 CDD:275368 16/21 (76%)
C2H2 Zn finger 505..525 CDD:275368 5/19 (26%)
C2H2 Zn finger 535..555 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6293
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.