| Sequence 1: | NP_524403.1 | Gene: | sqz / 42300 | FlyBaseID: | FBgn0010768 | Length: | 535 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001083017.1 | Gene: | znf362b / 100038768 | ZFINID: | ZDB-GENE-070424-35 | Length: | 438 | Species: | Danio rerio |
| Alignment Length: | 227 | Identity: | 101/227 - (44%) |
|---|---|---|---|
| Similarity: | 133/227 - (58%) | Gaps: | 27/227 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 108 PPTPHEQQEQKYDPNRSP------------PRQQMSSASGSGS-----------NGSSPEEESRR 149
Fly 150 GDGDQAKPYKCGSCSKSFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDKPY 214
Fly 215 KCRHAGCPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHLKTHICNL 279
Fly 280 CGKSYTQETYLQKHLQKHAEKAEKQQHRHTAQ 311 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sqz | NP_524403.1 | C2H2 Zn finger | 160..180 | CDD:275368 | 14/19 (74%) |
| zf-H2C2_2 | 172..197 | CDD:290200 | 16/24 (67%) | ||
| zf-C2H2 | 186..208 | CDD:278523 | 13/21 (62%) | ||
| C2H2 Zn finger | 188..208 | CDD:275368 | 12/19 (63%) | ||
| zf-C2H2_8 | 191..271 | CDD:292531 | 45/79 (57%) | ||
| zf-H2C2_2 | 200..227 | CDD:290200 | 19/26 (73%) | ||
| C2H2 Zn finger | 216..238 | CDD:275368 | 15/21 (71%) | ||
| C2H2 Zn finger | 246..266 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 277..297 | CDD:275368 | 11/19 (58%) | ||
| znf362b | NP_001083017.1 | C2H2 Zn finger | 247..267 | CDD:275368 | 3/21 (14%) |
| zf-H2C2_2 | 259..284 | CDD:290200 | 11/26 (42%) | ||
| C2H2 Zn finger | 275..295 | CDD:275368 | 14/19 (74%) | ||
| zf-H2C2_2 | 287..312 | CDD:290200 | 16/24 (67%) | ||
| C2H2 Zn finger | 303..323 | CDD:275368 | 12/19 (63%) | ||
| zf-H2C2_2 | 315..342 | CDD:290200 | 19/26 (73%) | ||
| C2H2 Zn finger | 331..353 | CDD:275368 | 15/21 (71%) | ||
| zf-H2C2_2 | 345..369 | CDD:290200 | 14/23 (61%) | ||
| C2H2 Zn finger | 361..381 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 395..411 | CDD:275368 | 9/15 (60%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 43 | 1.000 | Domainoid score | I12363 |
| eggNOG | 1 | 0.900 | - | - | E33208_3BF42 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 1 | 1.000 | - | - | otm25947 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.900 | |||||